PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g08820.1
Common NameGL2-1, LOC4344832, Os08g0187500, P0020B10.22, P0547A06.49, ROC1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 785aa    MW: 84615.4 Da    PI: 5.5932
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g08820.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-20107163157
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  LOC_Os08g08820.1 107 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 163
                       688999************************************************995 PP

2START207.93.9e-652995191206
                       HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
             START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                       ela +a++elv++a+++ep+W++ss      ++++e+ + f+++ +      ++ea+r  +vv+m++ +lve+l+d++ q+ + +     +a+
  LOC_Os08g08820.1 299 ELAVAAMDELVQMAQLDEPLWSSSSepaaALLDEEEYARMFPRGLGpkqygLKSEASRHGAVVIMTHSNLVEILMDVN-QFATVFSsivsRAS 390
                       57899********************99999999********99888999*****************************.88888888888*** PP

                       EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEE CS
             START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtw 166
                       t+ev+s+g      galq+m++e+q++splvp R+++fvRy++  ++g+w++vdvS+ds ++ p    v +++++pSg+li++++ng+skvtw
  LOC_Os08g08820.1 391 THEVLSTGvagnynGALQVMSMEFQVPSPLVPtRESYFVRYCKNNSDGTWAVVDVSLDSLRPSP----VQKCRRRPSGCLIQEMPNGYSKVTW 479
                       **************************************************************99....79999******************** PP

                       EE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 167 vehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       vehv+++++++h+++++lv+sgla+gak+wv tl+rqce+
  LOC_Os08g08820.1 480 VEHVEVDDSSVHNIYKPLVNSGLAFGAKRWVGTLDRQCER 519
                       **************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-2289162IPR009057Homeodomain-like
SuperFamilySSF466895.43E-2094164IPR009057Homeodomain-like
PROSITE profilePS5007117.07104164IPR001356Homeobox domain
SMARTSM003892.3E-20105168IPR001356Homeobox domain
CDDcd000861.35E-19106165No hitNo description
PfamPF000466.4E-18107162IPR001356Homeobox domain
PROSITE patternPS000270139162IPR017970Homeobox, conserved site
PROSITE profilePS5084839.771290522IPR002913START domain
SuperFamilySSF559615.92E-35291521No hitNo description
CDDcd088754.63E-122294518No hitNo description
SMARTSM002349.9E-61299519IPR002913START domain
PfamPF018528.8E-54300519IPR002913START domain
Gene3DG3DSA:3.30.530.207.4E-7365518IPR023393START-like domain
SuperFamilySSF559614.03E-24541774No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 785 aa     Download sequence    Send to blast
MTPARRMPPV IGRNGVAYES PSAQLPLTQA DMLDSHHLQQ ALQQQYFDQI PVTTTAAADS  60
GDNMLHGRAD AGGLVDEFES KSCSENVDGA GDGLSGDDQD PNQRPRKKRY HRHTQHQIQE  120
MEAFFKECPH PDDKQRKELS RELGLEPLQV KFWFQNKRTQ MKNQHERHEN AQLRAENDKL  180
RAENMRYKEA LSSASCPNCG GPAALGEMSF DEHHLRVENA RLRDEIDRIS GIAAKHVGKP  240
PIVSFPVLSS PLAVAAARSP LDLAGAYGVV TPGLDMFGGA GDLLRGVHPL DADKPMIVEL  300
AVAAMDELVQ MAQLDEPLWS SSSEPAAALL DEEEYARMFP RGLGPKQYGL KSEASRHGAV  360
VIMTHSNLVE ILMDVNQFAT VFSSIVSRAS THEVLSTGVA GNYNGALQVM SMEFQVPSPL  420
VPTRESYFVR YCKNNSDGTW AVVDVSLDSL RPSPVQKCRR RPSGCLIQEM PNGYSKVTWV  480
EHVEVDDSSV HNIYKPLVNS GLAFGAKRWV GTLDRQCERL ASAMASNIPN GDLGVITSVE  540
GRKSMLKLAE RMVASFCGGV TASVAHQWTT LSGSGAEDVR VMTRKSVDDP GRPPGIVLNA  600
ATSFWLPVPP AAVFDFLRDE TSRSEWDILS NGGAVQEMAH IANGRDHGNS VSLLRVNSAN  660
SNQSNMLILQ ESCTDASGSY VVYAPVDIVA MNVVLNGGDP DYVALLPSGF AILPDGPSGN  720
AQAAVGENGS GSGGGSLLTV AFQILVDSVP TAKLSLGSVA TVNSLIACTV ERIKAAVCRD  780
SNPQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.119880.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379901190.0
Expression AtlasQ6ZAR0-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Specifically expressed in the L1-layer of the meristem and protoderm (epidermis) of leaf primordia. During leaf development, expressed in protoderm from plastochron 1 (P1) to P4 and down-regulated at P5 to then disappear. Expressed in the epidermis of primary rachis branch, and in the protoderm of secondary rachis branch primordia. Expressed similarly in L1-layer or protoderm in young and developed floral shoots. During embryogenesis, expressed in the outermost (epidermal) cells 2 days after pollination (DAP) and later at 4 DAP in protodermal cells without any organ differentiation. In nearly mature embryo, strongly expressed in protoderm in the shoot apical meristem (SAM) and lateral organ primordia. {ECO:0000269|PubMed:11846882}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in protoderm differentiation and radial pattern formation during early embryogenesis. {ECO:0000269|PubMed:11846882}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g08820.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g08820
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0779930.0AB077993.1 Oryza sativa mRNA for Roc1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650023.10.0PREDICTED: homeobox-leucine zipper protein ROC1 isoform X2
SwissprotQ6ZAR00.0ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1
TrEMBLI1QG770.0I1QG77_ORYGL; Uncharacterized protein
STRINGLOC_Os08g08820.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Ito M, et al.
    Position dependent expression of GL2-type homeobox gene, Roc1: significance for protoderm differentiation and radial pattern formation in early rice embryogenesis.
    Plant J., 2002. 29(4): p. 497-507
    [PMID:11846882]