PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g07970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 418aa    MW: 45610.5 Da    PI: 6.8641
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g07970.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.42.4e-11106142238
                       XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeL 38 
                       +++k +rr+++NReAAr+sR+RKka+i++Le+   +L
  LOC_Os08g07970.1 106 PRDKIQRRLAQNREAARKSRLRKKAYIQNLETSRMKL 142
                       57999*************************9854444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-4105162IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.531107149IPR004827Basic-leucine zipper domain
PfamPF001701.5E-8107142IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-7109155No hitNo description
Gene3DG3DSA:1.20.5.1706.4E-8110155No hitNo description
PROSITE patternPS000360112127IPR004827Basic-leucine zipper domain
PfamPF141442.8E-27194268IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MTSAAPAAAQ FAAPAPAAMG IYDRRHHPLA AGVWGDHPFI RPDTTASTSN AAAAAMVVAP  60
PPLTEPKFES QLALPLQHGD DQDNAAALQE SPRHASDSFE QEASKPRDKI QRRLAQNREA  120
ARKSRLRKKA YIQNLETSRM KLAHLEQEIT RARQQSAYIN RSSNPATLPA PIDSGVVTFE  180
VEYAQWVEEQ GRQTAELRAS LQAAAEGPEL RAVVEAALAH YDRLFAAKRE AARRDVFFVM  240
SGVWRTGAER FFLWIAGFRP SEVIRVLAPQ LEPMTERQAA DVQGLQQKAR HLEDALSQGM  300
DKLKQTLADS LLAEAVVVST SCDASPPPPP PEEEEPSSSA AGDGGCYMAQ MGSAMGRLSN  360
LVAFVDHADH LRQETLQNMY KILTLPQAAR GLLALGDYCQ RLRALSSLWA ARPREPA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.200770.0leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329922370.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g07970.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g07970
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8315140.0CT831514.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA129B22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650460.10.0PREDICTED: transcription factor TGA6 isoform X2
SwissprotQ391621e-117TGA4_ARATH; Transcription factor TGA4
TrEMBLB8BB800.0B8BB80_ORYSI; Putative uncharacterized protein
STRINGLOC_Os08g07970.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26791132
MonocotsOGMP35713877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.21e-117TGACG motif-binding factor 4