PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g06370.1
Common NameLOC4344718, P0577B11.102, P0672D01.118
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 323aa    MW: 33785.1 Da    PI: 7.4843
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g06370.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.1e-32160213255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       pr+rWt++LH+rFv+ave LGG+++AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  LOC_Os08g06370.1 160 PRMRWTSTLHARFVHAVELLGGHDRATPKSVLELMDVKDLTLAHVKSHLQMYRT 213
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.2E-16157214IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-29158214IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-24160213IPR006447Myb domain, plants
PfamPF002495.1E-7161212IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MELFPSQPDL SLQIGLPTGA AAAAHGHGLN ARFFAAAAGA GGHNPAMASS PPSSLQLPLP  60
MPLPMAPAGA GGLQFYPDAA AAAAAAMLRP IRGVPLYHHH QQQHAAAAPF VGAAPLPHHP  120
SSGGACYCEP CHVAGAWRRG GCGGGGARGV LPAKRAPRAP RMRWTSTLHA RFVHAVELLG  180
GHDRATPKSV LELMDVKDLT LAHVKSHLQM YRTVKNTERP AASSDQADGF ENGSAGEICD  240
ENSLDLHGGC RPEAMSAAAR HGREDWSGFH ESNTGTMQTL KDMQSKSLEI ISDMNSCVSE  300
TTSSTSELNL EFTLGRPQNR PN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1011940.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154749000.0
Expression AtlasQ84UP8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g06370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g06370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0055040.0AP005504.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0577B11.
GenBankAP0046350.0AP004635.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0672D01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648944.10.0PREDICTED: probable transcription factor KAN2 isoform X2
TrEMBLQ84UP80.0Q84UP8_ORYSJ; Myb family transcription factor-like protein
STRINGLOC_Os08g06370.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5701580
MonocotsOGMP47213665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.12e-38G2-like family protein