PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g06120.1
Common NameLOC107277666, Os08g0157700, OsJ_26107, P0498E12.101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family B3
Protein Properties Length: 288aa    MW: 30720 Da    PI: 4.8026
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g06120.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B386.22.8e-2771160192
                       EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                       f+kv tpsdv+k++rlv+pk++ae++    + +++l +ed+ g  W+++++y+++s++yv+tkGW++Fv+a +L +gD+v F++    ++++
  LOC_Os08g06120.1  71 FDKVVTPSDVGKLNRLVVPKQHAERFFPAAAAGTQLCFEDRAGTPWRFRYSYWGSSQSYVMTKGWSRFVRAARLSAGDTVSFSRA--ADGRY 160
                       89************************666678889************************************************43..45544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.2E-3666159IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.31E-2768162IPR015300DNA-binding pseudobarrel domain
CDDcd100174.00E-2369162No hitNo description
SMARTSM010191.5E-1871172IPR003340B3 DNA binding domain
PROSITE profilePS5086313.94471168IPR003340B3 DNA binding domain
PfamPF023621.3E-2471160IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MYMDLTLGGA LLQVEEATEE EEEEEEEEQA LGQEPAPAAA AAALVLGRRH GVVVGGGGGG  60
VVVAAEREHM FDKVVTPSDV GKLNRLVVPK QHAERFFPAA AAGTQLCFED RAGTPWRFRY  120
SYWGSSQSYV MTKGWSRFVR AARLSAGDTV SFSRAADGRY FIDYRHCHRH GGRDISFASA  180
ATAMPAAAWP LFGRVQTAAP VSYGGGHGSA AAATMFLDTV APVAAAGGHR GEVGPSGQRS  240
FRLFGVNVEC GGDVDAAAEE EDADDDVDDG DHRRGEEMEL VMWTNHR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A2e-366816511115DNA-binding protein RAV1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ7EZD5
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g06120.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g06120
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0046980.0AP004698.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0498E12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649372.10.0PREDICTED: putative B3 domain-containing protein Os08g0157700
SwissprotQ7EZD50.0Y8577_ORYSJ; Putative B3 domain-containing protein Os08g0157700
TrEMBLI1QFT71e-153I1QFT7_ORYGL; Uncharacterized protein
STRINGLOC_Os08g06120.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1448744
MonocotsOGMP141642426
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61970.11e-46B3 family protein