PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g06110.2
Common NameLOC4344703, Os08g0157600, OsJ_26106, OSNPB_080157600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 720aa    MW: 78520.5 Da    PI: 5.7797
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g06110.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding475.8e-152468147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      r rWT+ E+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  LOC_Os08g06110.2 24 RERWTEAEHNRFLEALKLYGRA-WQRIEEHVG-TKTAVQIRSHAQKF 68
                      78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.84E-161874IPR009057Homeodomain-like
PROSITE profilePS5129419.5931973IPR017930Myb domain
TIGRFAMsTIGR015571.5E-162271IPR006447Myb domain, plants
SMARTSM007176.6E-122371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-82464IPR009057Homeodomain-like
PfamPF002492.7E-122467IPR001005SANT/Myb domain
CDDcd001671.26E-82669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 720 aa     Download sequence    Send to blast
MEINSSGEEA VVKVRKPYTI TKQRERWTEA EHNRFLEALK LYGRAWQRIE EHVGTKTAVQ  60
IRSHAQKFFT KLEKEAINNG TSPGQAHDID IPPPRPKRKP NSPYPRKSCL SSETSTREVQ  120
NDKATISNMT NNSTAQMAGD AALEKLQRKE ISEKGSCSEV LNLFREVPSA SFSSVNKSSS  180
NHGASRGLEP TKTEVKDVVI LERDSISNGA GKDAKDINDQ EMERLNGIHI SSKPDHSHEN  240
CLDTSSQQFK PKSNSVETTY VDWSAAKASH YQMDRNGVTG FQATGTEGSH PDQTSDQMGG  300
ASGTMNQCIH PTLPVDPKFD GNAAAQPFPH NYAAFAPMMQ CHCNQDAYRS FANMSSTFSS  360
MLVSTLLSNP AIHAAARLAA SYWPTVDGNT PDPNQENLSE SAQGSHAGSP PNMASIVTAT  420
VAAASAWWAT QGLLPLFPPP IAFPFVPAPS APFSTADVQR AQEKDIDCPM DNAQKELQET  480
RKQDNFEAMK VIVSSETDES GKGEVSLHTE LKISPADKAD TKPAAGAETS DVFGNKKKQD  540
RSSCGSNTPS SSDIEADNAP ENQEKANDKA KQASCSNSSA GDNNHRRFRS SASTSDSWKE  600
VSEEGRLAFD ALFSRERLPQ SFSPPQVEGS KEISKEEEDE VTTVTVDLNK NAAIIDQELD  660
TADEPRASFP NELSNLKLKS RRTGFKPYKR CSVEAKENRV PASDEVGTKR IRLESEAST*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.149310.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1160121360.0
Expression AtlasQ0J7W9-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00654PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g06110.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g06110
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2427710.0AK242771.1 Oryza sativa Japonica Group cDNA, clone: J090053J23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649844.10.0PREDICTED: protein LHY isoform X2
RefseqXP_015649845.10.0PREDICTED: protein LHY isoform X2
SwissprotQ6R0H14e-45LHY_ARATH; Protein LHY
TrEMBLQ0J7W90.0Q0J7W9_ORYSJ; Os08g0157600 protein
STRINGLOC_Os08g06110.20.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1297144
MonocotsOGMP60313447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.12e-41circadian clock associated 1