PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g05520.1
Common NameLOC4344665, Os08g0151300, OsJ_26048, OSNPB_080151300, P0443G08.130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 360aa    MW: 39954.7 Da    PI: 6.6241
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g05520.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
  LOC_Os08g05520.1 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                      788*******************************************97 PP

2Myb_DNA-binding55.61.2e-1767111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rgr+T+eE++l++ +++  G++ W+ Ia++++ gRt++++k++w+++
  LOC_Os08g05520.1  67 RGRFTAEEEKLIISLHAIVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                       89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.264961IPR017930Myb domain
SuperFamilySSF466898.99E-3011108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.8E-151461IPR001005SANT/Myb domain
CDDcd001675.17E-121761No hitNo description
PROSITE profilePS5129425.93262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-2565116IPR009057Homeodomain-like
SMARTSM007172.1E-1766114IPR001005SANT/Myb domain
PfamPF002493.9E-1667111IPR001005SANT/Myb domain
CDDcd001672.15E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF TAEEEKLIIS LHAIVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKPA  120
AAAAAATTTS PNNPPPCSTA TSDHHHLPPP AFGGADHHLQ LDAIINQNLI SSLPPKLATG  180
DDSPPAVPGL PHHCPLFMFD TTTTGAGGAI SPPPPSSLIP THLHHHHHPF IASFTAAMAA  240
DTPSYLPPLV DGMAAMGAAM DCSLEDGQTA AAMAATNGYY QHHQKHQQLE IELEEEEQRQ  300
LGHHHHQHHH EHEHENHQWD EEEAQHLLMW DQEVLTSSNL EAMQSGAHSL LFMGPNDHD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26141167108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.498300.0root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379884710.0
Expression AtlasQ84PW8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g05520.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g05520
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1118080.0AK111808.1 Oryza sativa Japonica Group cDNA clone:J013114D05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648990.10.0PREDICTED: protein rough sheath 2
TrEMBLQ84PW80.0Q84PW8_ORYSJ; Myb transcription factor (ATMYB4)-like protein
STRINGLOC_Os08g05520.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP60323757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.14e-83myb domain protein 103