PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g05510.2
Common NameLOC4344664, Os08g0151000, OSNPB_080151000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 252aa    MW: 26823.5 Da    PI: 10.5085
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g05510.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.32e-14107151347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE+  ++ + ++lG+g+W+ I++ + ++Rt+ q+ s+ qky
  LOC_Os08g05510.2 107 PWTEEEHRTFLAGLEKLGKGDWRGISKNFVTTRTPTQVASHAQKY 151
                       8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.431100156IPR017930Myb domain
SuperFamilySSF466896.58E-18101156IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-18103155IPR006447Myb domain, plants
SMARTSM007173.5E-11104154IPR001005SANT/Myb domain
PfamPF002493.1E-12107151IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-12107150IPR009057Homeodomain-like
CDDcd001673.01E-10107152No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MPQDSRPAAM RLFGVTISPP PPPPEPEPEP DPSDPRDPSP RPAREDAMRK CKSMGNLAAA  60
AAASSAAAGG GGAGDAGGSG DGYLSDGGLL LSSGKRRRAQ ERKKAVPWTE EEHRTFLAGL  120
EKLGKGDWRG ISKNFVTTRT PTQVASHAQK YFLRQTNPNK KKRRSSLFDM MATDMSPAPN  180
CPVLPPSMGK LHDMVAMTKQ LQNSSLEGVS SSSTVNLAPQ VARDLPPPIP SFKATNVDSS  240
LSKMNHMNLL R*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1159163KKKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.261091e-177callus| flower| leaf| panicle| root| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976079741e-177
Expression AtlasA0A0P0XBW5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g05510.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g05510
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2420170.0AK242017.1 Oryza sativa Japonica Group cDNA, clone: J075110L24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648292.10.0PREDICTED: transcription factor MYB1R1 isoform X2
SwissprotQ8S9H74e-34DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0P0XBW50.0A0A0P0XBW5_ORYSJ; Os08g0151000 protein
STRINGLOC_Os08g05510.11e-180(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-val !E d>Description
AT5G47390.16e-38MYB_related family protein