PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g04840.1
Common NameLOC4344650, Os08g0144000, OsJ_26018, OSNPB_080144000, P0025F03.25
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 384aa    MW: 40214.3 Da    PI: 8.9696
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g04840.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.99.9e-13104148347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +W++eE+++++ +  +lG+g+W+ I+r     Rt+ q+ s+ qky
  LOC_Os08g04840.1 104 AWSEEEHKKFLLGLSKLGKGDWRGISRNYVGSRTPTQVASHAQKY 148
                       7**************************9988*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.102.7E-41938IPR001878Zinc finger, CCHC-type
PROSITE profilePS501588.6972035IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.04997153IPR017930Myb domain
SuperFamilySSF466895.07E-1699154IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-16100152IPR006447Myb domain, plants
SMARTSM007177.5E-10101151IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-9103147IPR009057Homeodomain-like
CDDcd001672.46E-9104149No hitNo description
PfamPF002491.2E-10104148IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MTRDGALPAS GGGGAAEGPR RCSQCGHHGH NARTCTARGP VKLFGVRIGD KPPTAAAGGG  60
GGMRKSASMG SLAQLAEGGG GGGGREEGYG SDGNDDKRRK RGEAWSEEEH KKFLLGLSKL  120
GKGDWRGISR NYVGSRTPTQ VASHAQKYFI RQTNVHRRKR RSSLFDMVID DSDDQPLSRT  180
SSQEVEVEEN LEDGHPVTAP VIPPAPVPML SSSLVPPPVP AMAPVAPGPV LTSASATLPV  240
SAVAPQTDEK EQVASGSNTT ETGAAIPEVM PPYGYPMMLP PYYPPAFVPM PYYGYVPVFY  300
APPGAVQAQH EVVKPVAVHS KPPVHIDELY SMSELSLKGE AGVKNGTPNS LLPPRPIGRP  360
DRQSAFHGKG PSDGSSNGLI PAK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.114580.0callus| leaf| panicle| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1943961040.0
Expression AtlasQ6ZDM0-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g04840.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g04840
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8372520.0EU837252.1 Oryza sativa Japonica Group clone KCB704E08 myb transcription factor mRNA, complete cds.
GenBankAK0736810.0AK073681.1 Oryza sativa Japonica Group cDNA clone:J033054K18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015651035.10.0PREDICTED: cyclin-dependent kinase 12
TrEMBLA0A0E0QE880.0A0A0E0QE88_ORYRU; Uncharacterized protein
TrEMBLQ6ZDM00.0Q6ZDM0_ORYSJ; Myb transcription factor
STRINGLOC_Os08g04840.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1447944
MonocotsOGMP129002629
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.12e-41MYB_related family protein