PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g04190.1
Common NameGL2-7, OJ1613_G04.7, Os08g0136000, Os08g0136100, OsJ_024924, P0680F05.46, ROC7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 750aa    MW: 80854 Da    PI: 6.3916
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g04190.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.86e-2189144156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  LOC_Os08g04190.1  89 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 144
                       688999***********************************************999 PP

2START2014.9e-632654911206
                       HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
             START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                       ela +a++elv++a+++ep+W      e + ++e+ ++f+++ +      ++ea+r+++vv+m+++ lve l+d++ qW+  +     +a+tl
  LOC_Os08g04190.1 265 ELAVAAMEELVRMAQLGEPLWAPALggEALGEEEYARTFPRGLGpkspeLRSEASRETAVVIMNHVSLVEMLMDVG-QWTALFSsivsRAATL 356
                       57899********************99999*********998889*******************************.99999999999***** PP

                       EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EE.SSEEEEEEEECTCEEEE CS
             START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRael.lpSgiliepksnghskv 164
                       ev+s+g      galqlm+ae+q++splvp R+  f+Ry++q+++g+w++vdvS+d  +       ++  +R+++ +pSg+li++++ng+skv
  LOC_Os08g04190.1 357 EVLSTGvagnhnGALQLMSAEFQMPSPLVPtRETQFLRYCKQHPDGTWAVVDVSLDGLRAGAGggcQPAAARGHRrRPSGCLIQEMPNGYSKV 449
                       *************************************************************9999********8537**************** PP

                       EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       twvehv+ +++++h+l++++v+sg+a+ga++wvatl+rqce+
  LOC_Os08g04190.1 450 TWVEHVEADDQMVHNLYKPVVNSGMAFGARRWVATLERQCER 491
                       ****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.5E-2375144IPR009057Homeodomain-like
SuperFamilySSF466892.38E-2076146IPR009057Homeodomain-like
PROSITE profilePS5007117.39486146IPR001356Homeobox domain
SMARTSM003891.1E-2087150IPR001356Homeobox domain
CDDcd000866.80E-2088147No hitNo description
PfamPF000462.3E-1889144IPR001356Homeobox domain
PROSITE patternPS000270121144IPR017970Homeobox, conserved site
PROSITE profilePS5084843.25256494IPR002913START domain
SuperFamilySSF559614.71E-34257493No hitNo description
CDDcd088751.15E-120260490No hitNo description
SMARTSM002347.2E-60265491IPR002913START domain
PfamPF018529.7E-53266491IPR002913START domain
Gene3DG3DSA:3.30.530.203.6E-5331490IPR023393START-like domain
SuperFamilySSF559614.85E-26511734No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    Send to blast
MQSLLDGHHH QLPSLLQQHH NGHHLLDQHQ QHQHQLPPQA TTTSESDGRA PRDELEMSKS  60
GGSDNLESGG GGGGGGSGGD QDPNQRPRKK RYHRHTQHQI QELEAFFKEC PHPDDKQRKE  120
LSRELGLEPL QVKFWFQNKR TQMKTQHERH ENNALRAENE KLRAENMRYK EALANASCPN  180
CGGPAAIGEM SFDEHHLRLE NARLRDEIDR ISAIAAKYVG KPAAAVSAAY PPLPPSNRSP  240
LDHMGIPGAG ADVFGADFDK PLVIELAVAA MEELVRMAQL GEPLWAPALG GEALGEEEYA  300
RTFPRGLGPK SPELRSEASR ETAVVIMNHV SLVEMLMDVG QWTALFSSIV SRAATLEVLS  360
TGVAGNHNGA LQLMSAEFQM PSPLVPTRET QFLRYCKQHP DGTWAVVDVS LDGLRAGAGG  420
GCQPAAARGH RRRPSGCLIQ EMPNGYSKVT WVEHVEADDQ MVHNLYKPVV NSGMAFGARR  480
WVATLERQCE RLASAMASNV ASSGDAGVIT TSEGRRSMLK LAERMVASFC GGVTASTTHQ  540
WTTLSGSGAE DVRVMTRKSV DDPGRPPGII LNAATSFWLP VPPSRVFDFL RDDSTRSEWD  600
ILSNGGVVQE MAHIANGRDH GNAVSLLRVN NANSNQSNML ILQECCTDAT GSYVIYAPVD  660
VVAMNVVLNG GDPDYVALLP SGFAILPDGP DGGGGSLLTV AFQILVDSVP TAKLSLGSVA  720
TVNSLIACTV ERIKAAITGD NGVAPPCPR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.205760.0callus| leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2119709340.0
Expression AtlasA3BPF2-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g04190.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g04190
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3185630.0AK318563.1 Oryza sativa Japonica Group cDNA, clone: J075197C04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648539.10.0PREDICTED: homeobox-leucine zipper protein ROC7
SwissprotA3BPF20.0ROC7_ORYSJ; Homeobox-leucine zipper protein ROC7
TrEMBLB9FYY90.0B9FYY9_ORYSJ; Os08g0136100 protein
STRINGLOC_Os08g04190.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2