PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g02300.1
Common NameLOC4344514
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 401aa    MW: 42429.1 Da    PI: 6.9338
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g02300.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.22.7e-52111391128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                       +ppGfrFhPt+eel+++yL+kkv++++++l +vi++vd++k+ePwd+++  k+ +  +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk
  LOC_Os08g02300.1  11 VPPGFRFHPTEEELLNYYLRKKVASEQIDL-DVIRDVDLNKLEPWDIQErcKIGSgPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDK 102
                       69****************************.9***************963444443456********************************** PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++++   + +g++ktLvfykgrap+g+k+dW+mheyrl
  LOC_Os08g02300.1 103 AIYN-AVHRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                       ****.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-567183IPR003441NAC domain
PROSITE profilePS5100555.73211183IPR003441NAC domain
PfamPF023656.5E-2812139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MSISVNGQSC VPPGFRFHPT EEELLNYYLR KKVASEQIDL DVIRDVDLNK LEPWDIQERC  60
KIGSGPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKAIYNAVHR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD DPATDTAAAT PTVTSAAAAA AAMAAAADGG QEDGWVVCRV  180
FKKKHHHKEA GGGGGKHGGD GSAGAKAAHA YSSSDDALDQ ILQYMGRSCK QEHELPSPQA  240
SGGGGAGAGS RPASRYLRPI DTVLGGHGFM KLPPLESPSA ATALSSTPST GGDAASSAAA  300
AAADHLLLHH HHRTDWAMMD RLVASHLNGA NSDAPDDQLC FDAADDDGLA YYSAAATRLL  360
GGANAGTDDD LWSFARSAAP PPPPPPPSSA TPERLSHVAL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-46818414166NAC domain-containing protein 19
4dul_A2e-46818414166NAC domain-containing protein 19
1ut7_B2e-46818414166NO APICAL MERISTEM PROTEIN
1ut7_A2e-46818414166NO APICAL MERISTEM PROTEIN
1ut4_B2e-46818414166NO APICAL MERISTEM PROTEIN
1ut4_A2e-46818414166NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.105810.0leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329950690.0
Expression AtlasG3M8D2-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g02300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g02300
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6340710.0JN634071.1 Oryza sativa Japonica Group secondary wall NAC transcription factor 2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648974.10.0PREDICTED: NAC domain-containing protein 43
SwissprotQ84WP61e-119NAC43_ARATH; NAC domain-containing protein 43
TrEMBLG3M8D20.0G3M8D2_ORYSJ; Secondary wall NAC transcription factor 2
STRINGLOC_Os08g02300.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP159738112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.16e-88NAC family protein
Publications ? help Back to Top
  1. Zhong R, et al.
    Transcriptional activation of secondary wall biosynthesis by rice and maize NAC and MYB transcription factors.
    Plant Cell Physiol., 2011. 52(10): p. 1856-71
    [PMID:21908441]