PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g02160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 335aa    MW: 36372 Da    PI: 10.6566
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g02160.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1583.9e-49311562128
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                       +pGfrFhPt+eel+ +yL++kvegk++++ e i+ vd+y+++PwdLp+ ++ ++kew+f+++rd+ky++g+r+nr+t sgyWkatg d+ v++
  LOC_Os08g02160.1  31 MPGFRFHPTEEELIEFYLRRKVEGKRFNI-ELIAFVDLYRYDPWDLPALASIGDKEWFFYVPRDRKYRNGDRPNRVTPSGYWKATGADRMVKV 122
                       79***************************.89***************888889**************************************** PP

               NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++++ +glkktLvfy g+apkg +++W+m+eyrl
  LOC_Os08g02160.1 123 EGDRPIGLKKTLVFYVGKAPKGLRSSWIMNEYRL 156
                       ********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.0330176IPR003441NAC domain
SuperFamilySSF1019419.55E-5730176IPR003441NAC domain
PfamPF023651.2E-2432156IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MRGSDHHQDV VAAPRGGGGG GDDGQAHDMV MPGFRFHPTE EELIEFYLRR KVEGKRFNIE  60
LIAFVDLYRY DPWDLPALAS IGDKEWFFYV PRDRKYRNGD RPNRVTPSGY WKATGADRMV  120
KVEGDRPIGL KKTLVFYVGK APKGLRSSWI MNEYRLPHGD ADRYQKEISL CRVYKRPGIE  180
DNFHLTGTTT KSSGSKAAAA MGKKHAAANR TSSTAAAAAP RLAPMFDGGG GGQARATASA  240
AKKQAATAAA AKRRHPRRHR RPWSLQRRRH STSSRVCSRV CHRWYGAPLT HGSPAGAGTG  300
DISHPTTCAG SGSGGEVGEQ GGGVPVQPTP LPTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-543217619165NO APICAL MERISTEM PROTEIN
1ut4_B3e-543217619165NO APICAL MERISTEM PROTEIN
1ut7_A3e-543217619165NO APICAL MERISTEM PROTEIN
1ut7_B3e-543217619165NO APICAL MERISTEM PROTEIN
4dul_A3e-543217619165NAC domain-containing protein 19
4dul_B3e-543217619165NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.284240.0flower| leaf| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329784110.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g02160.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g02160
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP0331890.0KP033189.1 Oryza sativa cultivar Dong Jin NAC-related protein 49 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006659059.11e-137PREDICTED: transcription factor JUNGBRUNNEN 1-like
TrEMBLA0A0C5CL550.0A0A0C5CL55_ORYSA; Oryza sativa cultivar Dong Jin NAC-related protein 49 mRNA (Fragment)
STRINGLOC_Os08g02160.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP77063650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-96NAC domain containing protein 35