PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os08g02070.1
Common NameLOC4344493, MADS26, Os08g0112700, P0498H04.24
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 223aa    MW: 25217.2 Da    PI: 7.4485
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os08g02070.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.48.9e-241056248
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                      rien   rqvtf+kRr+g+lKKA ELS+LC+a++ +iifs +gkly+
  LOC_Os08g02070.1 10 RIENPVHRQVTFCKRRAGLLKKARELSILCEADIGIIIFSAHGKLYD 56
                      8********************************************97 PP

2K-box49.51.8e-1780171999
             K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLe.sLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                       ++  +    +qe+  Lk+ei+ Lq+ +R + G+  +  ++++eL+ Le+ Le  + +iRs K+++++++i+ l+ ke +l+ +n+ L++k+ 
  LOC_Os08g02070.1  80 ACGDQRMDPKQEAMVLKQEINLLQKGLRYIYGNRANeHMTVEELNALERYLEIWMYNIRSAKMQIMIQEIQALKSKEGMLKAANEILQEKIV 171
                       4445556679**********************998626****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.917161IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-33160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-26176IPR002100Transcription factor, MADS-box
CDDcd002652.45E-38279No hitNo description
PRINTSPR004041.4E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.3E-221055IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-253859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.20185176IPR002487Transcription factor, K-box
PfamPF014862.0E-2186170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MARGKVQLRR IENPVHRQVT FCKRRAGLLK KARELSILCE ADIGIIIFSA HGKLYDLATT  60
GTMEELIERY KSASGEQANA CGDQRMDPKQ EAMVLKQEIN LLQKGLRYIY GNRANEHMTV  120
EELNALERYL EIWMYNIRSA KMQIMIQEIQ ALKSKEGMLK AANEILQEKI VEQNGLIDVG  180
MMVADQQNGH FSTVPLLEEI TNPLTILSGY STCRGSEMGY SF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-15170169MEF2C
5f28_B4e-15170169MEF2C
5f28_C4e-15170169MEF2C
5f28_D4e-15170169MEF2C
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.41740.0flower| panicle| root| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329791460.0
Expression AtlasQ0J8G8-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaves and spikelets (rice flower). {ECO:0000269|Ref.7}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Function -- GeneRIF ? help Back to Top
  1. Data indicate that MADS-box transcription factor OsMADS26 acts as an upstream regulator of stress-associated genes.
    [PMID: 26424158]
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os08g02070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs08g02070
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0033260.0AB003326.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:R3786.
GenBankAK0691220.0AK069122.1 Oryza sativa Japonica Group cDNA clone:J023004P21, full insert sequence.
GenBankAY5519250.0AY551925.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS220 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650791.11e-164MADS-box transcription factor 26
SwissprotA2YQK91e-165MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G81e-165MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLI1QF311e-163I1QF31_ORYGL; Uncharacterized protein
STRINGOS08T0112700-011e-164(Oryza sativa)
STRINGORGLA08G0003200.11e-164(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.19e-63AGAMOUS-like 12
Publications ? help Back to Top
  1. Shinozuka Y, et al.
    Isolation and characterization of rice MADS box gene homologues and their RFLP mapping.
    DNA Res., 1999. 6(2): p. 123-9
    [PMID:10382970]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  4. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]