PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g48870.1
Common NameLOC4344354, Os07g0688200, OSNPB_070688200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 301aa    MW: 33702.9 Da    PI: 5.7254
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g48870.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.63.3e-192168148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT eEd+llv++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  LOC_Os07g48870.1 21 RGPWTVEEDLLLVNYIAAHGEGRWNALARCAGLKRTGKSCRLRWLNYL 68
                      89********************************************97 PP

2Myb_DNA-binding52.89.4e-1774117146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg++T+eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  LOC_Os07g48870.1  74 RGNMTAEEQLLILELHGRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 117
                       89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6681668IPR017930Myb domain
SuperFamilySSF466896.74E-3119115IPR009057Homeodomain-like
SMARTSM007173.3E-162070IPR001005SANT/Myb domain
PfamPF002494.7E-172168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-232275IPR009057Homeodomain-like
CDDcd001671.10E-122368No hitNo description
PROSITE profilePS5129423.7569123IPR017930Myb domain
SMARTSM007174.8E-1573121IPR001005SANT/Myb domain
PfamPF002492.0E-1574117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2276122IPR009057Homeodomain-like
CDDcd001677.85E-1276117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MMMAREVSSE EEAGGGDELR RGPWTVEEDL LLVNYIAAHG EGRWNALARC AGLKRTGKSC  60
RLRWLNYLRP DVRRGNMTAE EQLLILELHG RWGNRWSKIA QHLPGRTDNE IKNYWRTRVQ  120
KHAKHLNCDV NSQQFKDLMR YLWMPRLLER IHRSSQSQSH DADDADLSVS AATSCITSDL  180
VVDAHHPPLA MADSNDSAAM WQQHQAPQMS VAGAPPPTTT MAQHVVLPTA AASCHQMQDQ  240
FVCARAAETT TCCWSESESL PGLAGLYYDD AAAALPEFDV ETMAMWGPED DPWYTQMLGL  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251812124126MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.326340.0callus| flower| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329886640.0
Expression AtlasQ0D3F9-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g48870.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g48870
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1034550.0AK103455.1 Oryza sativa Japonica Group cDNA clone:J033129J22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645266.10.0PREDICTED: myb-related protein 340
TrEMBLA0A0E0I5Y10.0A0A0E0I5Y1_ORYNI; Uncharacterized protein
TrEMBLQ0D3F90.0Q0D3F9_ORYSJ; MYB transcription factor
STRINGLOC_Os07g48870.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.16e-81myb domain protein 112