PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g48630.1
Common NameLOC4344331, OJ1200_C08.104, Os07g0685700, OsEIL2, OsJ_25629, OSNPB_070685700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family EIL
Protein Properties Length: 594aa    MW: 65146.9 Da    PI: 5.2134
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g48630.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3501.63.9e-153814691354
                       XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.....XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaa....tgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasd 89 
                       eel++rmw+d++++krlke ++++ +++++a     g +++++s+eqarrkkmsraQDgiLkYMlk+mevcnaqGfvYgiipekgkpv+gasd
  LOC_Os07g48630.1  81 EELERRMWRDRVRHKRLKELQQSRAGRESRAgdagGGGRQQRQSQEQARRKKMSRAQDGILKYMLKMMEVCNAQGFVYGIIPEKGKPVSGASD 173
                       8**********************99999988888888899***************************************************** PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHH CS
              EIN3  90 sLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwg 182
                       +Lr+WWkekv+fdrngpaai+kyqa+n++++ + +   ++ + +hsl+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWP+G+e+ww+
  LOC_Os07g48630.1 174 NLRSWWKEKVRFDRNGPAAIAKYQADNAVPGCDGDAGGAAPAGPHSLHELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPEGSEAWWP 266
                       *********************************999888****************************************************** PP

                       HHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XXXXXXXXXX CS
              EIN3 183 elglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ssslrkqspk 273
                       e+g++k+ g+ppykkphdlkkawkv+vLtavikhmsp+++++r+l+rqsk+lqdkm+ake  ++l+vl+qee+++ ++++   ++    ++ +
  LOC_Os07g48630.1 267 EAGVPKELGPPPYKKPHDLKKAWKVAVLTAVIKHMSPDVDKVRRLVRQSKCLQDKMTAKEIVTWLAVLKQEEDLYLKLHPGalPPP--LSAAS 357
                       ********************************************************************************965444..47889 PP

                       XXXXXXXXXXXXXXXXXX.XXXXXXXXXX................................XXXXXXXXXXXXXXXXXXXXX......XXXXX CS
              EIN3 274 vtlsceqkedvegkkeskikhvqavktta................................gfpvvrkrkkkpsesakvsskevsrtcqssqf 334
                       +++s + ++dveg +  +  + + +k+++                                ++++++kr  +p+   +  s+  ++tc + q+
  LOC_Os07g48630.1 358 FNASVSGEYDVEGVDGDEAGNNNLQKAQNdatafmdltttmdaalsnnkflimplmkeeaiDVDFIQKRS-EPELMLSSDSHARVYTCGNVQC 449
                       9***********5555554555555555556899***********************************9.55555555666678******** PP

                       XX.XXXXXXXXXXXXXXXXX CS
              EIN3 335 rgsetelifadknsisqney 354
                       ++s+++l+f d+n+++ ++y
  LOC_Os07g48630.1 450 PHSNYALGFLDRNERNAHQY 469
                       ******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048736.8E-12981338No hitNo description
Gene3DG3DSA:1.10.3180.101.2E-70217346IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167683.27E-58218341IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020104anatomyleaf sheath
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MMGAAVTMVD RRMAFAAEAD VDSKAAFGFF GGECFVGEGD LVNPAPPPPQ QQQVHEGGFA  60
AEDESDGDDD DDDDDDVDDI EELERRMWRD RVRHKRLKEL QQSRAGRESR AGDAGGGGRQ  120
QRQSQEQARR KKMSRAQDGI LKYMLKMMEV CNAQGFVYGI IPEKGKPVSG ASDNLRSWWK  180
EKVRFDRNGP AAIAKYQADN AVPGCDGDAG GAAPAGPHSL HELQDTTLGS LLSALMQHCD  240
PPQRRFPLEK GVPPPWWPEG SEAWWPEAGV PKELGPPPYK KPHDLKKAWK VAVLTAVIKH  300
MSPDVDKVRR LVRQSKCLQD KMTAKEIVTW LAVLKQEEDL YLKLHPGALP PPLSAASFNA  360
SVSGEYDVEG VDGDEAGNNN LQKAQNDATA FMDLTTTMDA ALSNNKFLIM PLMKEEAIDV  420
DFIQKRSEPE LMLSSDSHAR VYTCGNVQCP HSNYALGFLD RNERNAHQYA CKHNAAAAAA  480
ESKPPPPHIF EPLGSFDFDL PVDGQRCLAG LMTMYDNDVA AATQMHHHHH QQQQANFFIR  540
DDAPFGGDVA ATAAAAPEFR FSSNFNVTGG GAVDYGGAMQ QPPAKYAGSN WFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A3e-702153461132Protein ETHYLENE INSENSITIVE 3
4zds_B3e-702153461132Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.104230.0callus| flower| leaf| panicle| root| seed| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154741580.0
Expression AtlasQ8W3L9-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g48630.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g48630
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0038180.0AP003818.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1200_C08.
GenBankAB0749720.0AB074972.2 Oryza sativa Japonica Group OsEIL2 mRNA for ethylene-insensitive-3-like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646574.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotQ9SLH01e-164EIL1_ARATH; ETHYLENE INSENSITIVE 3-like 1 protein
TrEMBLQ8W3L90.0Q8W3L9_ORYSJ; EIL transcription factor
STRINGLOC_Os07g48630.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5631682
MonocotsOGMP63838168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27050.11e-137ETHYLENE-INSENSITIVE3-like 1
Publications ? help Back to Top
  1. Hiraga S, et al.
    Involvement of two rice ETHYLENE INSENSITIVE3-LIKE genes in wound signaling.
    Mol. Genet. Genomics, 2009. 282(5): p. 517-29
    [PMID:19798512]