PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g48596.1
Common NameLOC4344327, Os07g0685300, OsJ_25625, OSNPB_070685300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 346aa    MW: 38253.5 Da    PI: 7.2252
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g48596.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1084.9e-3452106155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       kprl+Wt+eLHerFveav+qLGG++kAtPkti++lm+++gLtl+h+kSHLQkYRl
  LOC_Os07g48596.1  52 KPRLKWTSELHERFVEAVNQLGGPDKATPKTIMRLMGIPGLTLYHLKSHLQKYRL 106
                       79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.69449109IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-3250107IPR009057Homeodomain-like
SuperFamilySSF466891.06E-1751107IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-2452107IPR006447Myb domain, plants
PfamPF002495.6E-1054105IPR001005SANT/Myb domain
PfamPF143791.3E-25154200IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MTGTEQMMYH QQQVQSDSQH LSSRPGLPPE KQFLLQGGAD SSSGLVLSTD AKPRLKWTSE  60
LHERFVEAVN QLGGPDKATP KTIMRLMGIP GLTLYHLKSH LQKYRLSKNL QSQANASRAQ  120
GVLGCSTTEI DKPCEGNGSP ASHLDLETQT NSSMHINEAL QMQIEVQRRL HEQLEVQRHL  180
QLRIEAQGKY LQSVLEKAQE ALGTIAVAET AATANASSSK RLQNEHTQLH HHQQQQQVGD  240
GSVDSCLTAC DCEGSHHSRS HGHRGEQDIL SIGLPPFEPA AARSGKEHHY LLFPNEPSRR  300
RSCSDERRRE MSTLQASELD LSINGRSSSH SHRRENIDLN GAGWS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.525240.0leaf| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329776630.0
Expression AtlasQ0D3I5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g48596.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g48596
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0676450.0AK067645.1 Oryza sativa Japonica Group cDNA clone:J013112H14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646570.10.0PREDICTED: myb family transcription factor APL isoform X2
TrEMBLI1QDC00.0I1QDC0_ORYGL; Uncharacterized protein
TrEMBLQ0D3I50.0Q0D3I5_ORYSJ; Os07g0685300 protein
STRINGLOC_Os07g48596.10.0(Oryza sativa Japonica Group)
STRINGORGLA07G0211200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
MonocotsOGMP35743879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.36e-78G2-like family protein