PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g48570.1
Common NameLOC4344326, Os07g0685000, OsJ_25624, OSJNBa0060O17.33, OSNPB_070685000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 477aa    MW: 50817.3 Da    PI: 5.4725
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g48570.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.56.9e-39104163261
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                       ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rn+PvG+grrk+k+s
  LOC_Os07g48570.1 104 PDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKSCQRYWTAGGSMRNLPVGAGRRKSKSS 163
                       7899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-31101161IPR003851Zinc finger, Dof-type
PfamPF027011.1E-31106162IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.528108162IPR003851Zinc finger, Dof-type
PROSITE patternPS013610110146IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MDDLAAASPP HPPPPPPESH VPPPPQTPEK DSCEDTGDMR ISEEKPCTDQ ELDADQMNSS  60
SFNSSSECEN QTPSNDEMTG SESKSEAAQT EGGGSSEEKV LKKPDKILPC PRCNSMDTKF  120
CYYNNYNINQ PRHFCKSCQR YWTAGGSMRN LPVGAGRRKS KSSTANYRSI LITGSNLAAP  180
AGDAPLYQLS IKGDQTATAV KFAPDSPLCN SMASVLKIGE QSKNAKPTST AQPRNGETQT  240
CPASGTTSDS PRNEPVNGAV SGHQNGIVGH SGVPPMHPIP CFPGPPFVYP WSPAWNGIPA  300
MAPPVCTAPA EPANSSDNGS TASVQWSMPP VMPVPGYFPV IPSSVWPFIS PWPNGAWSSP  360
WIQPNCSVSA SSPTSTSTCS DNGSPVLGKH SRDSKPQGDD KAEKNLWIPK TLRIDDPDEA  420
AKSSIWTTLG IEPGDRSMFR SFQSKPESRE QISGAARVLQ ANPAALSRSQ SFQETT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.102350.0callus| flower| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329758340.0
Expression AtlasQ84PD2-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g48570.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g48570
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2244300.0AY224430.1 Oryza sativa (japonica cultivar-group) isolate 20587 AOBP-like protein mRNA, complete cds.
GenBankAK1040950.0AK104095.1 Oryza sativa Japonica Group cDNA clone:001-032-E07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647890.10.0PREDICTED: cyclic dof factor 2
TrEMBLQ84PD20.0Q84PD2_ORYSJ; AOBP-like protein
STRINGLOC_Os07g48570.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-81cycling DOF factor 2
Publications ? help Back to Top
  1. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]