PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g48560.1
Common NameLOC4344325, Os07g0684900, OsJ_25623, WOX11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WOX
Protein Properties Length: 263aa    MW: 27587.8 Da    PI: 8.4515
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g48560.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.12e-152080257
                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                      r+R+t+++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  LOC_Os07g48560.1 20 RSRWTPKPEQILILESIFNSgMVNPPKDETVRIRKLLerfgAVGDANVFYWFQNRRSRSRR 80
                      89*****************99*************************************997 PP

2Wus_type_Homeobox107.39.1e-351982265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +r+RWtP+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++q
   LOC_Os07g48560.1 19 VRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLERFGAVGDANVFYWFQNRRSRSRRRQ 82
                       589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.2561681IPR001356Homeobox domain
SuperFamilySSF466897.7E-141787IPR009057Homeodomain-like
SMARTSM003893.9E-61885IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-82088IPR009057Homeodomain-like
PfamPF000463.7E-132080IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MDGGHSPDRH AAAAAGEPVR SRWTPKPEQI LILESIFNSG MVNPPKDETV RIRKLLERFG  60
AVGDANVFYW FQNRRSRSRR RQRQLQAQAQ AAAAAASSGS PPTASSGGLA PGHAGSPASS  120
LGMFAHGAAG YSSSSSSSWP SSPPSVGMMM GDVDYGGGGD DLFAISRQMG YMDGGGGSSS  180
SAAAGQHQQQ QLYYSCQPAT MTVFINGVAT EVPRGPIDLR SMFGQDVMLV HSTGALLPAN  240
EYGILLHSLQ MGESYFLVTR SS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.517140.0callus| flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329832550.0
Expression AtlasQ0D3I7-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g48560.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g48560
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0732320.0AK073232.1 Oryza sativa Japonica Group cDNA clone:J033021B15, full insert sequence.
GenBankAK0635030.0AK063503.1 Oryza sativa Japonica Group cDNA clone:001-116-E11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645719.10.0PREDICTED: WUSCHEL-related homeobox 11
SwissprotQ0D3I70.0WOX11_ORYSJ; WUSCHEL-related homeobox 11
TrEMBLA0A0D3GV390.0A0A0D3GV39_9ORYZ; Uncharacterized protein
TrEMBLB8B6440.0B8B644_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0I5U20.0A0A0E0I5U2_ORYNI; Uncharacterized protein
TrEMBLA0A0E0QCW80.0A0A0E0QCW8_ORYRU; Uncharacterized protein
STRINGBGIOSGA026413-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os07g48560.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP46971222
MonocotsOGMP107837109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.12e-36WUSCHEL related homeobox 11
Publications ? help Back to Top
  1. Dai M,Hu Y,Zhao Y,Liu H,Zhou DX
    A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development.
    Plant Physiol., 2007. 144(1): p. 380-90
    [PMID:17351053]