PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g48450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 347aa    MW: 37533.5 Da    PI: 7.3901
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g48450.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.11.5e-52121391128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeel+ +yL+ ++++ ++++  +i++vdiyk++PwdLp+k+  +e+ewyfFs+rd+ky++g r+nra+ sgyWkatg+dk+++
  LOC_Os07g48450.1  12 LPPGFRFHPTDEELILHYLRSRATAGQCPV-PIIADVDIYKFDPWDLPSKAVYGESEWYFFSPRDRKYPNGIRPNRAAGSGYWKATGTDKPIH 103
                       79****************************.88***************77667899************************************* PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++ +ge vg+kk Lvfy+gr pkg+kt+W+mheyrl
  LOC_Os07g48450.1 104 DSaTGESVGVKKALVFYRGRPPKGTKTSWIMHEYRL 139
                       9988999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-643177IPR003441NAC domain
PROSITE profilePS5100560.52112177IPR003441NAC domain
PfamPF023653.9E-2713139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MEMTMSSAAT SLPPGFRFHP TDEELILHYL RSRATAGQCP VPIIADVDIY KFDPWDLPSK  60
AVYGESEWYF FSPRDRKYPN GIRPNRAAGS GYWKATGTDK PIHDSATGES VGVKKALVFY  120
RGRPPKGTKT SWIMHEYRLA ADPLAAAANT YKPSSSSRFR NVSMRLDDWV LCRIYKKSGQ  180
ASPMMPPLAA DYDHDEPSGV LDDAYSFYAP PMISTTLIPK LPKIPSISEL FDEHALAQIF  240
DAAADPPADH HQHALAVHPS LNQLLGVGDN FLAECYPSTA STATVAGGKR KASPAGDYAG  300
GGHTPAKRLN GSCFDVAPQS VVGGLQATPS SVLAGLNHQM LPPQLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-721118219173NAC domain-containing protein 19
3swm_B6e-721118219173NAC domain-containing protein 19
3swm_C6e-721118219173NAC domain-containing protein 19
3swm_D6e-721118219173NAC domain-containing protein 19
3swp_A6e-721118219173NAC domain-containing protein 19
3swp_B6e-721118219173NAC domain-containing protein 19
3swp_C6e-721118219173NAC domain-containing protein 19
3swp_D6e-721118219173NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.185950.0callus| flower| leaf| panicle| root| seed| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329786230.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g48450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g48450
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8293690.0CT829369.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA056N06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647490.10.0PREDICTED: NAC transcription factor 29
SwissprotO492555e-83NAC29_ARATH; NAC transcription factor 29
SwissprotQ8H4S41e-82NAC10_ORYSJ; NAC transcription factor ONAC010
TrEMBLA0A0E0QCV30.0A0A0E0QCV3_ORYRU; Uncharacterized protein
TrEMBLI1QDA40.0I1QDA4_ORYGL; Uncharacterized protein
STRINGLOC_Os07g48450.10.0(Oryza sativa Japonica Group)
STRINGORGLA07G0209600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP123736123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.14e-83NAC-like, activated by AP3/PI