PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g48180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 379aa    MW: 40143.9 Da    PI: 6.655
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g48180.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.48.7e-10175222552
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                       kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   
  LOC_Os07g48180.1 175 KRAKRILANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLF 222
                       9****************************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-14171235IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.599173236IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.05E-10175226No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-10175229No hitNo description
PfamPF001708.9E-9175220IPR004827Basic-leucine zipper domain
CDDcd147032.54E-22176225No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MAMPPKPGDQ PSPGRSPNPN LNLPCPLPPI PSCGGGGGGA GPTPPPPPPP PHHRRARSEV  60
AFRFPDDLGL GGGADGGGFD EIGSEDDLFS TFMDMEKIAG ADRDRAAETS SPPRPTKHRH  120
SASFDGFAFG AGAGGPGPGL GKQQDGAGGV FSEVMEAKKA MSSEQLAELA AIDPKRAKRI  180
LANRQSAARS KERKARYITE LERKVQTLQT EATTLSAQLT LFQRDTTGLS AENAELKIRL  240
QAMEQQAQLR DALNDALKQE VERLKIATGE MAKSNDAYNT GMQQVPYSPS FFQLSDQHAV  300
QHHAGVQQLP HQFQQPHPSV PSHQMLSHPN SLSDMMQQDS LGRLQGLDIG KGPVAVKNEA  360
EVVVKSEGSS ISAGGEGH*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.542130.0callus| leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329877710.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g48180.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g48180
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1025620.0AK102562.1 Oryza sativa Japonica Group cDNA clone:J033097I23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646776.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P41e-142RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0E0I5Q60.0A0A0E0I5Q6_ORYNI; Uncharacterized protein
STRINGLOC_Os07g48180.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12617181
MonocotsOGMP26833683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-79bZIP family protein