PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g47140.1
Common NameLOC4344220, Os07g0667300, OSNPB_070667300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CO-like
Protein Properties Length: 381aa    MW: 40357.9 Da    PI: 4.8289
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g47140.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.22.2e-052154336
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg 36
                      +r+C+ ++  ++  +C+ ++  lC  C  + H  
  LOC_Os07g47140.1 21 ARCCDFCGGLPAVVYCRADSARLCLPCDRHVHAA 54
                      689**************************99965 PP

2CCT62.91e-21339379343
               CCT   3 aallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                         ++RYkeKrk+R+F+K+irYesRKa+A+ R R+KGrF+k+
  LOC_Os07g47140.1 339 TVISRYKEKRKNRRFDKQIRYESRKARADGRLRIKGRFAKS 379
                       5689***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.0E-111966IPR000315B-box-type zinc finger
PROSITE profilePS501199.7411966IPR000315B-box-type zinc finger
CDDcd000216.95E-82466No hitNo description
PROSITE profilePS5101714.932337379IPR010402CCT domain
PfamPF062031.7E-16339379IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MARDDDPAKK LAVDGGVAAA ARCCDFCGGL PAVVYCRADS ARLCLPCDRH VHAANTVSTR  60
HARAPLCSAC RAAPAAAFHR GDGFLCSSCD FDERLRRGSI GGGGDELPLD DRAAVEGYTG  120
CPSIGELAAI LGVVGGDSDK PADDGWWSAS WEEEAPQVLS LDDIIVPTTS CHGLRPLLTP  180
PSPENQSSPD NGELDGEVVR QLGELARSEA AAQATFVAGD QLASWASPEF TSGHGDFGIE  240
AASTTVPSCE NETWIMSTDC TDPTDASKTD IAREEAPASS SAEPCLSSLV EISEICRSMS  300
YSGSGIDNGG HDPSTLAIMP TQALPKKGVY DIAYPDRGTV ISRYKEKRKN RRFDKQIRYE  360
SRKARADGRL RIKGRFAKSN *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.460060.0callus| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379897240.0
Expression AtlasQ0D3T5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g47140.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g47140
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1201010.0AK120101.1 Oryza sativa Japonica Group cDNA clone:J013022K23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645435.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 13 isoform X1
TrEMBLA2YPQ30.0A2YPQ3_ORYSI; Putative uncharacterized protein
TrEMBLQ0D3T50.0Q0D3T5_ORYSJ; Os07g0667300 protein
STRINGBGIOSGA023751-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os07g47140.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7906812
MonocotsOGMP37592222
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47890.13e-43B-box type zinc finger protein with CCT domain