PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g44950.1
Common NameLOC4344086, OJ1003_C06.133, OJ1458_B07.101, Os07g0644100, OSNPB_070644100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 569aa    MW: 60071.6 Da    PI: 5.6826
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g44950.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.61.7e-15111171363
                       XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                       e kr  r+ +NRe+A  sRqRKk+++eeLe kvk+++a   +L  +++  + e a+lk+++
  LOC_Os07g44950.1 111 EAKRRARLVRNRESAHQSRQRKKQYVEELEGKVKVMQATIADLTARISCVTAENAALKQQL 171
                       78********************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.0E-14109173IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.415111171IPR004827Basic-leucine zipper domain
PfamPF001707.8E-14111171IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.0E-17113171No hitNo description
SuperFamilySSF579599.38E-14113171No hitNo description
CDDcd147046.81E-22114165No hitNo description
PROSITE patternPS000360117131IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
MAEPDLLAPF ADLPFPPGDD FPDFPTLGDD AFALEDFDLD DLDFDFDVDL FPPDAPPPVT  60
TSSSSSAAGS PEAGTSSAGD GGSKNEESAD SSSPSRSGSD GGGGKDGKDD EAKRRARLVR  120
NRESAHQSRQ RKKQYVEELE GKVKVMQATI ADLTARISCV TAENAALKQQ LGGAAGAGAA  180
APPPPMPMYP AVYPLPMPWI HPAYAMRGSQ VPLVPIPRLK TQQPASTPEP PAKKARKTKK  240
VAGVSLLGLL FLMMVCGCLV PAVNRMYGAA YTGEGAAIVP SHHGRILAVE GPQNSVSNGV  300
DPKVPQNGSE TLPALLYLPR NGKHVKINGN LVIKSIVASE KASSRLSNYG EKGSGNQGKE  360
ETSLAIPGYV APLEAGEVMD SAKGMNELMA LAPGDGSIYR EDDGMLPQWF SEAMSGPMLN  420
SGMCTEVFQF DLSPTTADAN GIVPVYSGSV TNTSQNYTEN LPSGPVQKVK NRRISYSEAI  480
PLRGSTSNDT DHFKAPPKNH SQSHAGRKPV SSVVVSVLAD PREASDRDGE GRISSNSLSR  540
IFVVVLIDSV KYVTYSCVLP FKSHSPHL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1004670.0callus| flower| leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379915210.0
Expression AtlasQ8LIB3-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g44950.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g44950
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1218980.0AK121898.1 Oryza sativa Japonica Group cDNA clone:J033105F09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647746.10.0PREDICTED: bZIP transcription factor 17
TrEMBLQ8LIB30.0Q8LIB3_ORYSJ; Os07g0644100 protein
STRINGLOC_Os07g44950.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP21711628
MonocotsOGMP111793035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-68bZIP family protein