PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g44090.3
Common NameLOC4344021, OsJ_25267
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 343aa    MW: 36168.2 Da    PI: 6.9426
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g44090.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.4e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  LOC_Os07g44090.3 14 RGLWSPEEDEKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61
                      788*******************************************97 PP

2Myb_DNA-binding53.55.4e-1767111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg++++eE++l+++++ +lG++ W+ Ia+ ++ gRt++++k++w++y
  LOC_Os07g44090.3  67 RGAFSQEEEDLIIHLHSMLGNK-WSQIAAQLP-GRTDNEVKNFWNSY 111
                       89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.176961IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-251064IPR009057Homeodomain-like
SuperFamilySSF466894.87E-3012108IPR009057Homeodomain-like
SMARTSM007173.1E-131363IPR001005SANT/Myb domain
PfamPF002491.3E-151461IPR001005SANT/Myb domain
CDDcd001674.05E-121761No hitNo description
PROSITE profilePS5129427.13862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2665116IPR009057Homeodomain-like
SMARTSM007176.4E-1666114IPR001005SANT/Myb domain
PfamPF002495.6E-1667111IPR001005SANT/Myb domain
CDDcd001671.91E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MAKRAGGARK KLRRGLWSPE EDEKLMNHIA KYGHGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGAF SQEEEDLIIH LHSMLGNKWS QIAAQLPGRT DNEVKNFWNS YIKKKLRQRG  120
IDPATHKPLA EVVAAAACAR TPAVFSDAEL ILSSIGAQPP PESYDGSRYS TECGAASVGG  180
DGSLSSLSGY SQATAEFAVD GASASALLHC GGGGPTSSGG GAPPAPTAAV IPSVSSSSTL  240
NSMVGLSPAA TTTTTTTDEQ YGNTNHLPWL ELGPSTTTPS SSAAAATFDH YGAALDELKW  300
SDYVFDGYNH QLPPYNHGGI YGGGDSKDTA VHFDAHALGN WC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.145250.0leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasA3BMJ9
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g44090.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g44090
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0043340.0AP004334.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0455H11.
GenBankAP0037520.0AP003752.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1332_C12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645477.10.0PREDICTED: myb-related protein Hv33
TrEMBLA3BMJ90.0A3BMJ9_ORYSJ; Uncharacterized protein
STRINGLOC_Os07g44090.30.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.19e-68myb domain protein 86