PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g44090.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 320aa    MW: 33368 Da    PI: 5.9726
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g44090.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.9e-174488147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      rg++++eE++l+++++ +lG++ W+ Ia+ ++ gRt++++k++w++y
  LOC_Os07g44090.2 44 RGAFSQEEEDLIIHLHSMLGNK-WSQIAAQLP-GRTDNEVKNFWNSY 88
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-112450IPR009057Homeodomain-like
SuperFamilySSF466893.18E-222497IPR009057Homeodomain-like
PROSITE profilePS500904.0542538IPR017877Myb-like domain
PROSITE profilePS5129427.1383993IPR017930Myb domain
SMARTSM007176.4E-164391IPR001005SANT/Myb domain
PfamPF002495.1E-164488IPR001005SANT/Myb domain
CDDcd001671.57E-114689No hitNo description
Gene3DG3DSA:1.10.10.601.0E-215190IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MAMAAGAPSP SLQKFQFVVA LGLERCGKSC RLRWINYLRP DLKRGAFSQE EEDLIIHLHS  60
MLGNKWSQIA AQLPGRTDNE VKNFWNSYIK KKLRQRGIDP ATHKPLAEVV AAAACARTPA  120
VFSDAELILS SIGAQPPPES YDGSRYSTEC GAASVGGDGS LSSLSGYSQA TAEFAVDGAS  180
ASALLHCGGG GPTSSGGGAP PAPTAAVIPS VSSSSTLNSM VGLSPAATTT TTTTDEQYGN  240
TNHLPWLELG PSTTTPSSSA AAATFDHYGA ALDELKWSDY VFDGYNHQLP PYNHGGIYGG  300
GDSKDTAVHF DAHALGNWC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-21259340108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.145250.0leaf| panicle| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g44090.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g44090
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0043340.0AP004334.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0455H11.
GenBankAP0037520.0AP003752.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1332_C12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645477.10.0PREDICTED: myb-related protein Hv33
TrEMBLA3BMJ90.0A3BMJ9_ORYSJ; Uncharacterized protein
STRINGLOC_Os07g44090.30.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.16e-48myb domain protein 86