PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g44090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 197aa    MW: 21236.7 Da    PI: 12.7587
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g44090.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding346.6e-111450137
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtl 37
                      rg W++eEde+l + ++++G g+W+++++  g  R +
  LOC_Os07g44090.1 14 RGLWSPEEDEKLMNHIAKYGHGCWSSVPKLAGGLRLR 50
                      788*****************************43444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.146959IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-131054IPR009057Homeodomain-like
SuperFamilySSF466893.93E-91054IPR009057Homeodomain-like
PfamPF002491.9E-91454IPR001005SANT/Myb domain
CDDcd001673.17E-71754No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MAKRAGGARK KLRRGLWSPE EDEKLMNHIA KYGHGCWSSV PKLAGGLRLR LSCRVGRTTR  60
SRTSGTLTSR RSFASAASIR PPTSRSPRSS PPPPAPARRR CSATPSSSCP PSAPSRRRRA  120
MMAAGTARSA APRVSAATGR CRRCPGTAKR QRSSRWTAPA RARCCTAAAA APPPPVVAPR  180
RRPRRRLSRR CRAPAR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197118RRRCSATPSSSCPPSAPSRRRR
2179186RRRPRRRL
3180185RRPRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.145250.0leaf| panicle| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g44090.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g44090
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8361720.0CT836172.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN040M10, full insert sequence.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.16e-14myb domain protein 50