PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g43580.1
Common NameLOC4343988, MYB
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 342aa    MW: 35258.9 Da    PI: 6.1552
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g43580.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd+ lv +v+++G+g+W++++ + g+ R+ k+c++rw +yl
  LOC_Os07g43580.1 14 KGPWTPEEDLVLVSYVQEHGPGNWRAVPTRTGLMRCSKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding51.23e-1667112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T +E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  LOC_Os07g43580.1  67 RGNFTDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.358965IPR017930Myb domain
SuperFamilySSF466895.87E-3011108IPR009057Homeodomain-like
SMARTSM007172.9E-131363IPR001005SANT/Myb domain
PfamPF002491.9E-161461IPR001005SANT/Myb domain
CDDcd001672.69E-111661No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2465116IPR009057Homeodomain-like
SMARTSM007173.2E-1666114IPR001005SANT/Myb domain
PROSITE profilePS5129420.60966116IPR017930Myb domain
PfamPF002495.9E-1567112IPR001005SANT/Myb domain
CDDcd001671.22E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MVRPPCCDKD GVKKGPWTPE EDLVLVSYVQ EHGPGNWRAV PTRTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKRKLQGGG  120
AGGDGDGGAA GDAVSPKPAA QRPASSSKGQ WERRLQTDID MARRALREAL TSLDDVKPPH  180
QPDAANAAAG GGGATTGAAA SAGADSPAAS STSGASQCSP SSAGYVLTTE NISRMLDGWA  240
RKKGGGGGRR AAGSGPATPG ATESASGSSE ASEVSYGGTA LSAAAAPASA FEYETKPTVT  300
AAAAADAGDE TQLSAIESWL FADADGIESG SLLDAAMDYT F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-27141164105C-Myb DNA-Binding Domain
1msf_C1e-27141164105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.255880.0callus| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1529261370.0
Expression AtlasQ7E198-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g43580.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g43580
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3234800.0AY323480.1 Oryza sativa (japonica cultivar-group) putative myb protein (MYB) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645343.10.0PREDICTED: transcription factor MYB30
TrEMBLQ7E1980.0Q7E198_ORYSJ; Putative myb protein
TrEMBLA0A0E0AN160.0A0A0E0AN16_9ORYZ; Uncharacterized protein
STRINGLOC_Os07g43580.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.12e-90myb domain protein 30