PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g43420.1
Common NameLOC4343977, OJ1339_F05.140, Os07g0627300, OsJ_25207, OSNPB_070627300, P0506F02.108
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 539aa    MW: 59595.2 Da    PI: 4.4695
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g43420.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.34.2e-143276348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +W+teEd+ l   ++++G+++W+ Ia+ +   +t+ qc+ rw++yl
  LOC_Os07g43420.1 32 SWSTEEDDVLRTQIALHGTDNWTIIAAQFK-DKTARQCRRRWYNYL 76
                      6****************************9.**************7 PP

2Myb_DNA-binding41.62.8e-1382125146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g W+ eEd+ll +a k lG++ W+ Ia+ +  gRt++ +k+r+ +
  LOC_Os07g43420.1  82 KGGWSREEDLLLCEAQKVLGNK-WTEIAKVVS-GRTDNAVKNRFST 125
                       688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.5172580IPR017930Myb domain
SuperFamilySSF466894.87E-2629123IPR009057Homeodomain-like
SMARTSM007171.6E-122978IPR001005SANT/Myb domain
CDDcd001671.40E-123276No hitNo description
Gene3DG3DSA:1.10.10.602.3E-183383IPR009057Homeodomain-like
PfamPF139211.8E-143392No hitNo description
PROSITE profilePS5129417.36781131IPR017930Myb domain
SMARTSM007173.5E-1381129IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-1984130IPR009057Homeodomain-like
CDDcd001672.41E-985126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009038anatomypalea
PO:0001048developmental stagepalea development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MATGPDLTPP AAAASAEAPS ASAAKKDRHI VSWSTEEDDV LRTQIALHGT DNWTIIAAQF  60
KDKTARQCRR RWYNYLNSEC KKGGWSREED LLLCEAQKVL GNKWTEIAKV VSGRTDNAVK  120
NRFSTLCKRR AKDDELFKEN GSLCSSTSSK RALVQTGCLT SGASGSAPPI KQMRPCNSDF  180
KENMTPNMRL VGQDKSTQDS RQPLAIVYQN NQDNMNTMDT QNLVAKTAAK QLFAGEQNCV  240
KHEGNFLNKD DPKIATLLQR ADLLCSLATK INTENTSQSM DEAWQQLQHH LDKKDDNDMS  300
ESSMSGMASL LEDLDDLIVD PYENEEEEDQ DLREQTEQID VENKQNSSQT SMEVTSQMVP  360
DNKMEDCPND KSTEDNNMEP CPGEDIPTSE NLTEAAIEDS LLQCVEYSSP VHTVIQAKTD  420
AEIAASENLS EVLEHNRLQC IQLASPAQTT TPVEANAETP ASEKLREVVK CNNPSCIEFT  480
SPAHTVPTFL PYADDMPTPK FTASERNFLL SVLELTSPGS RPDTSQQPSC KRALLNSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-293313010107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.249830.0callus| leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329734440.0
Expression AtlasQ8LI26-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g43420.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g43420
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0634260.0AK063426.1 Oryza sativa Japonica Group cDNA clone:001-115-D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647542.10.0PREDICTED: myb-like protein Q
TrEMBLA0A0E0QBJ80.0A0A0E0QBJ8_ORYRU; Uncharacterized protein
TrEMBLQ8LI260.0Q8LI26_ORYSJ; Myb-related protein-like
STRINGLOC_Os07g43420.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP54161421
MonocotsOGMP89033847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.24e-84MYB family protein