PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g43030.1
Common NameP0524E08.109
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CAMTA
Protein Properties Length: 1027aa    MW: 114672 Da    PI: 6.6665
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g43030.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1180.42.1e-56211372118
              CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptf 94 
                       l+ ++rwl+++ei++iL n++k++++ e+++rp sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+hekLKvg+v+vl+cyYah+een++f
  LOC_Os07g43030.1  21 LEAQNRWLRPTEICHILSNYKKFSIAPEPPNRPASGSLFLFDRKILRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSVDVLHCYYAHGEENENF 113
                       5679***************************************************************************************** PP

              CG-1  95 qrrcywlLeeelekivlvhylevk 118
                       qrr+ywlLee + +ivlvhylevk
  LOC_Os07g43030.1 114 QRRTYWLLEEGFMNIVLVHYLEVK 137
                       *********************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143779.84616142IPR005559CG-1 DNA-binding domain
SMARTSM010762.5E-7619137IPR005559CG-1 DNA-binding domain
PfamPF038593.4E-5022136IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.106.5E-5430517IPR013783Immunoglobulin-like fold
PfamPF018331.5E-4431504IPR002909IPT domain
SuperFamilySSF812961.71E-16431517IPR014756Immunoglobulin E-set
SuperFamilySSF484031.71E-16618724IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.7E-17623725IPR020683Ankyrin repeat-containing domain
CDDcd002047.08E-13624722No hitNo description
PROSITE profilePS5029717.263630724IPR020683Ankyrin repeat-containing domain
PfamPF127964.3E-7636725IPR020683Ankyrin repeat-containing domain
SMARTSM002480.055663692IPR002110Ankyrin repeat
PROSITE profilePS500889.618663695IPR002110Ankyrin repeat
SMARTSM00248670702731IPR002110Ankyrin repeat
SMARTSM000154.2836858IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.718837866IPR000048IQ motif, EF-hand binding site
SuperFamilySSF525402.1E-7838887IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF006120.0055838857IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0096859881IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.633860884IPR000048IQ motif, EF-hand binding site
PfamPF006122.4E-4862881IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0050826Biological Processresponse to freezing
GO:0005634Cellular Componentnucleus
GO:0001077Molecular Functiontranscriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0005516Molecular Functioncalmodulin binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1027 aa     Download sequence    Send to blast
MAEVRKYGLP NQPPDIPQIL LEAQNRWLRP TEICHILSNY KKFSIAPEPP NRPASGSLFL  60
FDRKILRYFR KDGHNWRKKK DGKTVKEAHE KLKVGSVDVL HCYYAHGEEN ENFQRRTYWL  120
LEEGFMNIVL VHYLEVKGKN NFSRVASKVS AVLKKLKRVQ DYLMLIVLHA QTLSLVRASV  180
SKEKFGATDN CRASSRYHPF VEMQQPVDGV MMNNMLGVSA PSAGYHGEMQ TTTANSDNHF  240
ATHYDIAGVF NEAGAGLRGV SKTLHDSVRF AEPYPECSAE FMEPALYSSN ATMESNNLDD  300
NSRLETFMSE ALYTNNLTQK EADALSAAGI MSSQAENNSY TDGIRYPLLK QSSLDLFKIE  360
PDGLKKFDSF SRWMSSELPE VADLDIKSSS DAFWSSTETV NVADGTSIPI NEQLDAFAVS  420
PSLSQDQLFS IIDVSPSYAC TGSRNKVLIT GTFLANKEHV ENCKWSCMFG DVEVPAEVLA  480
HGSLRCYTPV HLSGRVPFYV TCSNRVACSE VREFEFRDSD ARQMDTSDPQ TTGINEMHLH  540
IRLEKLLSLG PDDYEKYVMS DGKEKSEIIN TISSLMLDDK CLNQAVPLDE KEVSTARDQN  600
IEKLVKEKLY CWLVHKVHDE DKGPNVLGKE GQGVIHLVAA LGYDWAVRPI ITAGVKVNFR  660
DARGWTALHW AASCGRERTV GALIANGAES GLLTDPTPQF PAGRTAADLA SENGHKGIAG  720
FLAESALTSH LSALTLKESK DGNVKEICGL GGAEDFAESS SAQLAYRDSQ AESLKDSLSA  780
VRKSTQAAAR IFQAFRVESF HRKKVVEYGD DDCGLSDERT LSLVSIKNAK PGQNDGSHSA  840
AVRIQNKFRG WKGRKEFMII RQKIVKIQAH VRGHQVRKSY RRIVWSVGIV EKIILRWRRK  900
RRGLRGFQPV KQLEGPSPIQ QLEGPSQIQP AKEEEEDEYD YLKDGRKQAE GRLQRALARV  960
KSMTQYPEAR EQYSRIANRV TELQEPQAMM IQDDMQSDGA IADGGDFMAE LEELCGDGDA  1020
PMPTIL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.594110.0callus| flower| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1172104360.0
Expression AtlasQ7XI44-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00501DAPTransfer from AT5G09410Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g43030.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g43030
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1084610.0AK108461.1 Oryza sativa Japonica Group cDNA clone:002-143-D08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647012.10.0PREDICTED: calmodulin-binding transcription activator 1 isoform X1
TrEMBLQ7XI440.0Q7XI44_ORYSJ; Putative anther ethylene-upregulated protein ER1
STRINGLOC_Os07g43030.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5621565
MonocotsOGMP60838140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09410.30.0ethylene induced calmodulin binding protein