PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g42400.1
Common NameLOC4343903, Os07g0615900, OSNPB_070615900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family FAR1
Protein Properties Length: 743aa    MW: 84435.7 Da    PI: 7.8799
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g42400.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA44.32.5e-1465101135
              GATA   1 CsnCgttk..TplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       C  Cg +   Tp++Rrgpdg++tLCnaCG+ yrk ++
  LOC_Os07g42400.1  65 CLRCGISGnaTPHMRRGPDGPRTLCNACGIAYRKGKM 101
                       5667777777************************876 PP

2FAR184.12.3e-26135222191
              FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                       +fYn+YA +vGFsvrks+s+ks+ n  ++ rtfvCs+eg+++++k+   +++++r  tr+gC a+l +k + ++k++vt+++ +HnH+lap
  LOC_Os07g42400.1 135 EFYNKYAGHVGFSVRKSTSHKSSGN-ITKVRTFVCSREGYNRDKKSL--EAKKPRLDTRIGCPARLIIKVTPESKYRVTDFKADHNHQLAP 222
                       6********************9444.47889************9988..99*************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004016.5E-661114IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.52E-1061112No hitNo description
CDDcd002021.16E-764102No hitNo description
Gene3DG3DSA:3.30.50.104.0E-1164103IPR013088Zinc finger, NHR/GATA-type
PfamPF003201.3E-1165100IPR000679Zinc finger, GATA-type
PfamPF031019.1E-24135222IPR004330FAR1 DNA binding domain
PfamPF105515.3E-25345439IPR018289MULE transposase domain
PROSITE profilePS509669.755613660IPR007527Zinc finger, SWIM-type
PfamPF044345.2E-5631659IPR007527Zinc finger, SWIM-type
SMARTSM005755.1E-6635662IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 743 aa     Download sequence    Send to blast
MRVWLGRVGG GDAMMHMLVA PDGGGGGEMP PPYGGAAAAP PPPMEQELEL HRDNADDGLD  60
GHVRCLRCGI SGNATPHMRR GPDGPRTLCN ACGIAYRKGK MRRMIEAEPP IDEAALAKLV  120
PEVGMEFESE DKAYEFYNKY AGHVGFSVRK STSHKSSGNI TKVRTFVCSR EGYNRDKKSL  180
EAKKPRLDTR IGCPARLIIK VTPESKYRVT DFKADHNHQL APPSTMHMLR SQRILTELQS  240
GEAELSDDSV MTPTTKATGD LVVRQIGFLR SISLLPADYK NYLRSKRMKA MQLGDGGAIL  300
KYLQTMQMEN PAFFYTMQID EDDKLTNFFW ADPKSREDFN YFGDVLCLDT TYKINGYGRP  360
LSLFLGVNHH KQTIVFGAAM LYDESFESYR WLFESFKIAM HGKQPAVALV DQSIPLASAM  420
AAAWPNTTQR TCAWHVYQNS LKHLNHVFQG SKTFAKDFSR CVFGYEEEEE FLFAWRSMLE  480
KYDLRHNEWL SKLFDERERW ALAYERHIFC ADIISALQAE SFSSVLKKFL GPQLDLLSFF  540
KHYERAVDEH RYAELQADFQ ASQSYPRIPP AKMLKQAAHT YTPVVFEIFR KEFELFMDSV  600
LFSCGEAGAT SEYKVAPSEK PKEHFVRFDS SDCSCICTCR KFEFMGIPCC HMLKVLDYRN  660
IKELPQRYLL KRWRRTAKSA NEENQGTLLF LICMRIHFAE AHDAGDLNLN IIPSARCLLH  720
DTGVEAVRTG HAELPRIKVS NL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.138760.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329763350.0
Expression AtlasB7EMP8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g42400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g42400
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0738030.0AK073803.1 Oryza sativa Japonica Group cDNA clone:J033068D01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647351.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5 isoform X1
TrEMBLB7EMP80.0B7EMP8_ORYSJ; Os07g0615900 protein
STRINGLOC_Os07g42400.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3012351
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-121FAR1-related sequence 5