PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g41580.1
Common NameLOC4343856, Os07g0606600, OsHAP3F, OSJNBa0072I06.11, OSNPB_070606600, P0493C06.26
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YB
Protein Properties Length: 225aa    MW: 23272.7 Da    PI: 7.0774
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g41580.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB184.48.6e-5821116297
             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                       reqdrflPianvsrimk++lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedy++plk+yl+k+rele
  LOC_Os07g41580.1  21 REQDRFLPIANVSRIMKRALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYIDPLKLYLHKFRELE 113
                       89******************************************************************************************* PP

             NF-YB  95 gek 97 
                       gek
  LOC_Os07g41580.1 114 GEK 116
                       *97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.8E-5318120IPR009072Histone-fold
SuperFamilySSF471137.14E-4023122IPR009072Histone-fold
PfamPF008081.6E-272690IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006156.9E-205472No hitNo description
PROSITE patternPS0068505773IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006156.9E-207391No hitNo description
PRINTSPR006156.9E-2092110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MPDSDNESGG PSNAGEYASA REQDRFLPIA NVSRIMKRAL PANAKISKDA KETVQECVSE  60
FISFITGEAS DKCQREKRKT INGDDLLWAM TTLGFEDYID PLKLYLHKFR ELEGEKAIGA  120
AGSGGGGAAS SGGSGSGSGS HHHQDASRNN GGYGMYGGGG GMIMMMGQPM YGSPPASSAG  180
YAQPPPPHHH HHQMVMGGKG AYGHGGGGGG GPSPSSGYGR QDRL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-4821111292Transcription factor HapC (Eurofung)
4g92_B5e-4821111292Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.497950.0leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379887810.0
Expression AtlasQ69J40-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g41580.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g41580
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0064580.0AP006458.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OSJNBa0072I06.
GenBankAP0051930.0AP005193.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0493C06.
GenBankAB2880370.0AB288037.1 Oryza sativa Japonica Group OsHAP3F gene for HAP3 subunit of HAP complex, complete cds.
GenBankAK1121180.0AK112118.1 Oryza sativa Japonica Group cDNA clone:002-139-C11, full insert sequence.
GenBankAK1116210.0AK111621.1 Oryza sativa Japonica Group cDNA clone:J013109P12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645521.11e-163PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotO233102e-71NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLB8B8B71e-163B8B8B7_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0QB031e-163A0A0E0QB03_ORYRU; Uncharacterized protein
TrEMBLQ69J401e-163Q69J40_ORYSJ; HAP3 subunit of HAP complex
STRINGBGIOSGA023925-PA1e-162(Oryza sativa Indica Group)
STRINGLOC_Os07g41580.11e-162(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16817170
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-71nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Thirumurugan T,Ito Y,Kubo T,Serizawa A,Kurata N
    Identification, characterization and interaction of HAP family genes in rice.
    Mol. Genet. Genomics, 2008. 279(3): p. 279-89
    [PMID:18193457]