PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g40570.1
Common NameLOC4343795, Os07g0596900, OSNPB_070596900, P0453E05.117
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 433aa    MW: 46333.5 Da    PI: 6.5069
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g40570.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.95.7e-30170226259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       dDgynWrKYGqK vkg e+p+sYY+Ct+ +C v+k+ve+sa d+++v+i+Y+g+H+he
  LOC_Os07g40570.1 170 DDGYNWRKYGQKAVKGGEYPKSYYKCTHLNCLVRKNVEHSA-DGRIVQIIYRGQHTHE 226
                       8****************************************.***************8 PP

2WRKY103.21.4e-32338396159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gC vkk+vers e+p++v++tYeg+H h+
  LOC_Os07g40570.1 338 LDDGYRWRKYGQKVVKGNPYPRSYYKCTYLGCDVKKQVERSVEEPNAVITTYEGKHIHD 396
                       59*******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.5E-27164228IPR003657WRKY domain
SuperFamilySSF1182901.57E-24167228IPR003657WRKY domain
SMARTSM007742.5E-32169227IPR003657WRKY domain
PROSITE profilePS5081123.376170228IPR003657WRKY domain
PfamPF031061.2E-22170226IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.1E-34325398IPR003657WRKY domain
SuperFamilySSF1182903.53E-29331398IPR003657WRKY domain
PROSITE profilePS5081134.762333398IPR003657WRKY domain
SMARTSM007742.3E-38338397IPR003657WRKY domain
PfamPF031064.2E-25339395IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MAAARRVAGG GGGSLWGPPQ PPPSTGGGIP QLPAAAAAPV EGLLDAPFSS SSGGGGGGWP  60
PPPPPLSGTA VLIGYPQGNF ETFPQQDLVP LTAQEVHSKC ITFGRAENLP FIPLATSALV  120
SQHTGSSSVN VTPLQEILTS PSQISNVNTE SIGVLQGLPA SSIVLDRPTD DGYNWRKYGQ  180
KAVKGGEYPK SYYKCTHLNC LVRKNVEHSA DGRIVQIIYR GQHTHERPSK RRFKDCGGIS  240
DDLDDFSGTT GTSVRSQPDY DDYCRKPIIP SGTMVAPLVK KIEDGDDQLS GSSDNQDEHD  300
DEVRTSDGAS GDASANERNV PAPGQKIIVS TTSEIDLLDD GYRWRKYGQK VVKGNPYPRS  360
YYKCTYLGCD VKKQVERSVE EPNAVITTYE GKHIHDVPAA RNKSHVVANA SLLQNTKSNT  420
YCTEQSYTTI TC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-34170399878Probable WRKY transcription factor 4
2lex_A3e-34170399878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.233840.0flower| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154731480.0
Expression AtlasQ84ZK2-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g40570.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g40570
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418470.0AY341847.1 Oryza sativa (japonica cultivar-group) WRKY6 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646950.10.0PREDICTED: probable WRKY transcription factor 3 isoform X1
TrEMBLQ84ZK20.0Q84ZK2_ORYSJ; Os07g0596900 protein
STRINGLOC_Os07g40570.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP134538122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.13e-76WRKY DNA-binding protein 3