PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g40020.1
Common NameLOC4343769, Os07g0589200, OsJ_24947, OSNPB_070589200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 474aa    MW: 50596.4 Da    PI: 5.2589
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g40020.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS297.63.2e-91774702373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn....sseelaalkl..fsevs 88 
                       ++lL++cA+a++++d++l+q++L+ l+++a  dgd++qRl+a f+ AL +r +r  ++ +ka+++  ++  +    ++++++a++l  f +++
  LOC_Os07g40020.1  77 EQLLVHCANAIEANDATLTQQILWVLNNIAPADGDSNQRLTAAFLCALVSRASR--TGACKAVTAAVADAVEsaalHVHRFTAVELasFIDLT 167
                       79***************************************************9..44454443333322221234666666666689***** PP

              GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfe 177
                       P+++f++ +aN aI+eaveg   vHi+D++ ++++Q p+L++ La R+egpp lR+T+ + + s         +ee+g +L +fA++ +++++
  LOC_Os07g40020.1 168 PWHRFGYTAANAAIVEAVEGFPVVHIVDLSTTHCMQIPTLIDMLAGRAEGPPILRLTVADVAPSApppaLDMPYEELGAKLVNFARSRNMSMD 260
                       **********************************************************9886666787777789******************* PP

              GRAS 178 fnvl.......vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles.........erdevLklvkslsPkvvvvveqeadhnsesFl 254
                       f+v+       +++ +++l++++L  + gEal+Vn+++ lh+++de++ + s          r+ +Lk ++ l P++vvvv+++ad ++++ +
  LOC_Os07g40020.1 261 FRVVptspadaLTSLVDQLRVQQLVSDGGEALVVNCHMLLHTVPDETAGSVSlttaqppvsLRTMLLKSLRALDPTLVVVVDEDADFTAGDVV 353
                       ****887666555566677777777777****************887665555445566657899**************************** PP

              GRAS 255 erflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksd 347
                        r+  a+++ +  +d++++ lp+ se+r+++E+e +g++++nv+a+eg er+er+e   +W +r+++aGF++++++e+aa ++k++l+ ++  
  LOC_Os07g40020.1 354 GRLRAAFNFLWIPYDAVDTFLPKGSEQRRWYEAE-VGWKVENVLAQEGVERVERQEDRTRWGQRMRAAGFRAAAFGEEAAGEVKAMLNDHA-A 444
                       **********************************.********************************************************.8 PP

              GRAS 348 gyrveeesgslvlgWkdrpLvsvSaW 373
                       g+ ++ e++ lvl+Wk++++v++SaW
  LOC_Os07g40020.1 445 GWGMKREDDDLVLTWKGHNVVFASAW 470
                       89999********************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.39350452IPR005202Transcription factor GRAS
PfamPF035141.1E-8877470IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009071anatomyanther wall tapetum
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MMQFTHTAPP PPPLHPNGHG LGLGLYLDVG ATRGGGGARP WSSSSSTTTL GGSGYFPSSA  60
AASKISLGNL NSTGCMEQLL VHCANAIEAN DATLTQQILW VLNNIAPADG DSNQRLTAAF  120
LCALVSRASR TGACKAVTAA VADAVESAAL HVHRFTAVEL ASFIDLTPWH RFGYTAANAA  180
IVEAVEGFPV VHIVDLSTTH CMQIPTLIDM LAGRAEGPPI LRLTVADVAP SAPPPALDMP  240
YEELGAKLVN FARSRNMSMD FRVVPTSPAD ALTSLVDQLR VQQLVSDGGE ALVVNCHMLL  300
HTVPDETAGS VSLTTAQPPV SLRTMLLKSL RALDPTLVVV VDEDADFTAG DVVGRLRAAF  360
NFLWIPYDAV DTFLPKGSEQ RRWYEAEVGW KVENVLAQEG VERVERQEDR TRWGQRMRAA  420
GFRAAAFGEE AAGEVKAMLN DHAAGWGMKR EDDDLVLTWK GHNVVFASAW APS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B9e-497747388475Protein SHORT-ROOT
5b3h_B2e-497747334421Protein SHORT-ROOT
5b3h_E2e-497747334421Protein SHORT-ROOT
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.609450.0callus| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976075470.0
Expression AtlasB9FY68-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g40020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g40020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0037500.0AP003750.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1174_G05.
GenBankAP0051490.0AP005149.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OSJNBb0005G07.
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645421.10.0scarecrow-like protein 32
SwissprotQ9SN221e-160SCL32_ARATH; Scarecrow-like protein 32
TrEMBLB9FY680.0B9FY68_ORYSJ; Os07g0589200 protein
STRINGOS07T0589200-000.0(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56973759
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-150GRAS family protein