PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g39800.1
Common NameLOC4343751, OJ1113_E01.111, Os07g0586700, OsJ_24924, OSNPB_070586700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HRT-like
Protein Properties Length: 623aa    MW: 68669.5 Da    PI: 9.6559
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g39800.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like57.22.7e-18311340130
          HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                       +CGv+ledGs C ++Pv+gRKRCe HKG+R
  LOC_Os07g39800.1 311 VCGVMLEDGSSCLDHPVQGRKRCELHKGRR 340
                       7****************************9 PP

2HRT-like52.77.1e-17585614130
          HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                       iCG++ +dGs+Ck+qP+ gRKRC+ HKG+R
  LOC_Os07g39800.1 585 ICGARASDGSPCKNQPIAGRKRCAMHKGQR 614
                       8****************************9 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 623 aa     Download sequence    Send to blast
MPAASAAVPA RLKREDYPRT KHDSLFSPWK VLVGPSDWED HAAGKEGIQR YRVLNLPENF  60
PGLYELGVAR ASDEGIRAAR RWNGSGGGGV VVVYLGQADS VRARLQQYGR TGSHLDAGNP  120
PPSAGEAETN TRATGNGLFR EVFVRGYSLV FRCALMGNKQ EAEKTEARLL RVFDYAWNKL  180
QNGGLRREEI LIKLEQGAVN NRSSLLSRVR HFKQEVFREK AGIKISRNGS VDVSSGIMKN  240
MLPRIRTFVG FRPQLVNSGD NVDKEIGIRW KNTSEGNSYG KQARRSSEGY KVKRVNVIKR  300
RTMPEQDSND VCGVMLEDGS SCLDHPVQGR KRCELHKGRR LGRITVNPKG SSCSYSCQVE  360
IPVVESISPL TENESESDQA QQTSELLSKF LPATVKKSSR PWYSFEAKEI KTGEAPIEDG  420
KQETSEVIDI CEAKKSDNSA CTNKVISGSK KCQLHNGCKA EEFVSSRVID LLQNEEKVKS  480
MTVDKLSGEE ISHGKYQSQE NQPSGRMWFE LIKLQNPTST LSSKGQGRQK RVTGNVAAIC  540
EALTDNRCRE TIPMAGRERC DAHEGIKVTD ASSVPFSGSS GWPSICGARA SDGSPCKNQP  600
IAGRKRCAMH KGQRACRTPS ID*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.380560.0callus| flower| leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329880010.0
Expression AtlasQ8H2Y0-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g39800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g39800
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1027920.0AK102792.1 Oryza sativa Japonica Group cDNA clone:J033107P15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644815.10.0PREDICTED: uncharacterized protein LOC4343751
TrEMBLA0A0E0AM070.0A0A0E0AM07_9ORYZ; Uncharacterized protein
TrEMBLQ8H2Y00.0Q8H2Y0_ORYSJ; Os07g0586700 protein
STRINGLOC_Os07g39800.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP52481420
MonocotsOGMP79483443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.11e-71effector of transcription2