PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g39480.1
Common NameLOC4343736, OJ1127_E01.114, Os07g0583700, OsJ_24901, OSNPB_070583700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 619aa    MW: 66163.6 Da    PI: 6.3317
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g39480.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.26.3e-32236293260
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       +DgynWrKYGqK+vkgse+prsYY+Ct+++C vkk +ers  d++++e++Y+g+Hnh+k
  LOC_Os07g39480.1 236 EDGYNWRKYGQKHVKGSENPRSYYKCTHPNCDVKKLLERSL-DGQITEVVYKGRHNHPK 293
                       8****************************************.***************85 PP

2WRKY106.41.5e-33409467159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYY+Ct +gCpv+k+ver+++dpk v++tYeg+Hnhe
  LOC_Os07g39480.1 409 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNTGCPVRKHVERASHDPKSVITTYEGKHNHE 467
                       59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-27229294IPR003657WRKY domain
PROSITE profilePS5081123.789230294IPR003657WRKY domain
SuperFamilySSF1182909.02E-25234294IPR003657WRKY domain
SMARTSM007748.3E-35235293IPR003657WRKY domain
PfamPF031063.5E-24236292IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-37394469IPR003657WRKY domain
SuperFamilySSF1182901.44E-29401469IPR003657WRKY domain
PROSITE profilePS5081138.526404469IPR003657WRKY domain
SMARTSM007741.7E-39409468IPR003657WRKY domain
PfamPF031062.5E-26410467IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 619 aa     Download sequence    Send to blast
MADSPNPSSG DHPAGVGGSP EKQPPVDRRV AALAAGAAGA GARYKAMSPA RLPISREPCL  60
TIPAGFSPSA LLESPVLLTN FKVEPSPTTG TLSMAAIMNK SANPDILPSP RDKTSGSTHE  120
DGGSRDFEFK PHLNSSSQST ASAINDPKKH ETSMKNESLN TALSSDDMMI DNIPLCSRES  180
TLAVNISSAP SQLVGMVGLT DSSPAEVGTS ELHQMNSSGN AMQESQPESV AEKSAEDGYN  240
WRKYGQKHVK GSENPRSYYK CTHPNCDVKK LLERSLDGQI TEVVYKGRHN HPKPQPNRRL  300
SAGAVPPIQG EERYDGVATT DDKSSNVLSI LGNAVHTAGM IEPVPGSASD DDNDAGGGRP  360
YPGDDAVEDD DLESKRRKME SAAIDAALMG KPNREPRVVV QTVSEVDILD DGYRWRKYGQ  420
KVVKGNPNPR SYYKCTNTGC PVRKHVERAS HDPKSVITTY EGKHNHEVPA SRNASHEMST  480
PPMKPVVHPI NSNMQGLGGM MRACEPRTFP NQYSQAAESD TISLDLGVGI SPNHSDATNQ  540
LQSSVSDQMQ YQMQPMGSVY SNMGLPAMAM PTMAGNAASN IYGSREEKPS EGFTFKATPM  600
DHSANLCYST AGNLVMGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-37236470878Probable WRKY transcription factor 4
2lex_A5e-37236470878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.188620.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329805610.0
Expression AtlasQ84ZS7-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g39480.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g39480
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418500.0AY341850.1 Oryza sativa (japonica cultivar-group) WRKY9 mRNA, complete cds.
GenBankAK0705370.0AK070537.1 Oryza sativa Japonica Group cDNA clone:J023062H03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646742.10.0PREDICTED: WRKY transcription factor SUSIBA2 isoform X1
SwissprotQ6VWJ60.0WRK46_HORVU; WRKY transcription factor SUSIBA2
TrEMBLQ5HZ670.0Q5HZ67_ORYSA; WRKY transcription factor 78
TrEMBLQ84ZS70.0Q84ZS7_ORYSJ; Os07g0583700 protein
STRINGLOC_Os07g39480.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP67403851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-125WRKY family protein