PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g39470.1
Common NameCIGR2, LOC4343735, OJ1127_E01.113, Os07g0583600, OsJ_24900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 545aa    MW: 60108.2 Da    PI: 6.4282
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g39470.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS437.11.3e-1331745431373
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l+elL++cA+av++++  +++ ++ +l++++s +g+p++Rl ay++e+L arla+s+ ++ykal+++e +   ss+ l+++++++e++P++kf
  LOC_Os07g39470.1 174 LKELLIACARAVEEKNSFAIDMMIPELRKIVSVSGEPLERLGAYMVEGLVARLASSGISIYKALKCKEPK---SSDLLSYMHFLYEACPYFKF 263
                       5799*****************************************************************9...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       +++ aN aI eav+ge+r+HiiDf isqG+QW++LlqaLa+Rp+gpp++RiTg++++ s   +   le +g+rL+++A+ ++vpfef++l a 
  LOC_Os07g39470.1 264 GYMSANGAIAEAVKGEDRIHIIDFHISQGAQWISLLQALAARPGGPPTVRITGIDDSVSAyaRGGGLELVGRRLSHIASLCKVPFEFHPL-AI 355
                       ********************************************************888899999************************6.77 PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       + +++e  +L v pgEalaVn+ l+lh+++desvs++++rd++L++vkslsPkv+++ve e+++n+++F +rf+e+l+yy+a+f+s++ +lpr
  LOC_Os07g39470.1 356 SGSKVEAAHLGVIPGEALAVNFTLELHHIPDESVSTANHRDRLLRMVKSLSPKVLTLVEMESNTNTAPFPQRFAETLDYYTAIFESIDLTLPR 448
                       89******************************************************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       +++eri++E+++l+reivn++aceg+er er e ++kW++rl++aGF+p pls+ +++++++ll+ ++ d y++ e++g+l+lgWk+rpLv+ 
  LOC_Os07g39470.1 449 DDRERINMEQHCLAREIVNLIACEGEERAERYEPFGKWKARLTMAGFRPSPLSSLVNATIRTLLQSYS-DNYKLAERDGALYLGWKSRPLVVS 540
                       ********************************************************************.55********************** PP

              GRAS 371 SaW 373
                       SaW
  LOC_Os07g39470.1 541 SAW 543
                       *** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.271148525IPR005202Transcription factor GRAS
PfamPF035144.3E-131174543IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MADTPTSRMI HPFSNIPSQN LKQFQYSDNP QHPCHPYRAP SDTHVVPHHY GLKSHSPDAG  60
YESQATPNKY TLDSSEGAGC MRHDSPSSQS FTTRSGSPLS QEDSHSDSTD GSPVGASCVT  120
EDPNDLKQKL KDLEAVMLGP DSEIVNSLEN SVANQLSLEP EKWVRMMGIP RGNLKELLIA  180
CARAVEEKNS FAIDMMIPEL RKIVSVSGEP LERLGAYMVE GLVARLASSG ISIYKALKCK  240
EPKSSDLLSY MHFLYEACPY FKFGYMSANG AIAEAVKGED RIHIIDFHIS QGAQWISLLQ  300
ALAARPGGPP TVRITGIDDS VSAYARGGGL ELVGRRLSHI ASLCKVPFEF HPLAISGSKV  360
EAAHLGVIPG EALAVNFTLE LHHIPDESVS TANHRDRLLR MVKSLSPKVL TLVEMESNTN  420
TAPFPQRFAE TLDYYTAIFE SIDLTLPRDD RERINMEQHC LAREIVNLIA CEGEERAERY  480
EPFGKWKARL TMAGFRPSPL SSLVNATIRT LLQSYSDNYK LAERDGALYL GWKSRPLVVS  540
SAWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-661785448375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.100610.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567642940.0
Expression AtlasQ8GVE1-
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g39470.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g39470
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0037470.0AP003747.5 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1127_E01.
GenBankAK0988900.0AK098890.1 Oryza sativa Japonica Group cDNA clone:J013001M01, full insert sequence.
GenBankAK0734700.0AK073470.1 Oryza sativa Japonica Group cDNA clone:J033044I02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646745.10.0PREDICTED: chitin-inducible gibberellin-responsive protein 2
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLA0A0E0QAE80.0A0A0E0QAE8_ORYRU; Uncharacterized protein
TrEMBLA2YN280.0A2YN28_ORYSI; Putative uncharacterized protein
TrEMBLI1QEP30.0I1QEP3_ORYGL; Uncharacterized protein
STRINGBGIOSGA026022-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os07g39470.10.0(Oryza sativa Japonica Group)
STRINGORGLA07G0258500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14091447
MonocotsOGMP151337117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Day RB,Shibuya N,Minami E
    Identification and characterization of two new members of the GRAS gene family in rice responsive to N-acetylchitooligosaccharide elicitor.
    Biochim. Biophys. Acta, 2003. 1625(3): p. 261-8
    [PMID:12591613]