PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g39320.1
Common NameHOX14, LOC4343726, OJ1301_C12.13, Os07g0581700, OsJ_023919, P0453G03.37
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 241aa    MW: 26283.4 Da    PI: 7.2375
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g39320.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.17.4e-1962115356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++++eq+e Le  F+++r++ + ++ +LA++lgL+ +qV vWFqNrRa++k
  LOC_Os07g39320.1  62 KKRRLSDEQVEMLELSFREERKLETGRKVHLASELGLDPKQVAVWFQNRRARHK 115
                       45589***********************************************99 PP

2HD-ZIP_I/II116.31.8e-3762152292
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       kkrrls+eqv++LE sF+ee+kLe+ rKv+la+eLgl+p+qvavWFqnrRAR+k+k lE+++++Lk+a+da   ++++Le+ev +L+e+l 
  LOC_Os07g39320.1  62 KKRRLSDEQVEMLELSFREERKLETGRKVHLASELGLDPKQVAVWFQNRRARHKSKLLEEEFSKLKHAHDAAILHKCHLENEVLRLKERLV 152
                       9**************************************************************************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.29357117IPR001356Homeobox domain
SuperFamilySSF466899.61E-1759116IPR009057Homeodomain-like
SMARTSM003899.7E-1760121IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.8E-1862115IPR009057Homeodomain-like
PfamPF000464.0E-1662115IPR001356Homeobox domain
CDDcd000863.44E-1562117No hitNo description
PRINTSPR000311.8E-58897IPR000047Helix-turn-helix motif
PROSITE patternPS00027092115IPR017970Homeobox, conserved site
PRINTSPR000311.8E-597113IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MDRYGEKQQQ QQMFASYVDA SLLAASGEVQ GERPRARRRR RRGARCVGGG GGGGEVDGGD  60
PKKRRLSDEQ VEMLELSFRE ERKLETGRKV HLASELGLDP KQVAVWFQNR RARHKSKLLE  120
EEFSKLKHAH DAAILHKCHL ENEVLRLKER LVVAEEEVRR LRSAAGSHTA SGEGGDIMGL  180
GGSGACVAGS PSSSFSTGTC QPPSFGGGDH LGDDDLVYVP EYGGYADNSV VEWFSLYGLI  240
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13241RPRARRRRRR
23644RRRRRRGAR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.62710.0callus| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO455930990.0
Expression AtlasQ7XI85-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaf blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00473DAPTransfer from AT4G36740Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g39320.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g39320
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1218890.0AK121889.1 Oryza sativa Japonica Group cDNA clone:J033105B17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646179.11e-175PREDICTED: homeobox-leucine zipper protein HOX14
SwissprotQ7XI851e-177HOX14_ORYSJ; Homeobox-leucine zipper protein HOX14
TrEMBLB8B7S81e-175B8B7S8_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA026014-PA1e-174(Oryza sativa Indica Group)
STRINGLOC_Os07g39320.11e-174(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP37761025
MonocotsOGMP200638101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.19e-32homeobox protein 40
Publications ? help Back to Top
  1. Agalou A, et al.
    A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members.
    Plant Mol. Biol., 2008. 66(1-2): p. 87-103
    [PMID:17999151]