PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g39220.1
Common NameBZR1, LOC4343719, Os07g0580500, OsJ_24880, P0453G03.22
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family BES1
Protein Properties Length: 299aa    MW: 31908.7 Da    PI: 8.6003
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g39220.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822221.71.5e-6861471145
            DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspess 93 
                       +++gr+ptwkErEnnkrRERrRRaiaaki++GLRa Gny+lpk++DnneVlkALcreAGwvvedDGttyrkg+kp+  ++a+g+s  +sp+ss
  LOC_Os07g39220.1   6 AAAGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYNLPKHCDNNEVLKALCREAGWVVEDDGTTYRKGCKPP-PSSAGGASVGMSPCSS 97 
                       589*************************************************************************.9999************ PP

            DUF822  94 lq.sslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlsl 145
                       +q +s+ ss+++spv+sy+asp+sssfpsps++d+ s+   ++llp+l+ l++
  LOC_Os07g39220.1  98 TQlLSAPSSSFPSPVPSYHASPASSSFPSPSRIDNPSA---SCLLPFLRGLPN 147
                       *********************************99866...588888876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.9E-648132IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009741Biological Processresponse to brassinosteroid
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0040008Biological Processregulation of growth
GO:0042742Biological Processdefense response to bacterium
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005829Cellular Componentcytosol
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009030anatomycarpel
PO:0007130developmental stagesporophyte reproductive stage
PO:0007606developmental stagegynoecium development stage
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MTSGAAAAGR TPTWKERENN KRRERRRRAI AAKIFTGLRA LGNYNLPKHC DNNEVLKALC  60
REAGWVVEDD GTTYRKGCKP PPSSAGGASV GMSPCSSTQL LSAPSSSFPS PVPSYHASPA  120
SSSFPSPSRI DNPSASCLLP FLRGLPNLPP LRVSSSAPVT PPLSSPTASR PPKIRKPDWD  180
VDPFRHPFFA VSAPASPTRG RRLEHPDTIP ECDESDVSTV DSGRWISFQM ATTAPTSPTY  240
NLVNPGASTS NSMEIEGTAG RGGAEFEFDK GRVTPWEGER IHEVAAEELE LTLGVGAK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.547810.0callus| flower| leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329919570.0
Expression AtlasQ7XI96-
Functional Description ? help Back to Top
Source Description
UniProtPositive brassinosteroid-signaling protein. Mediates downstream brassinosteroid-regulated growth response and feedback inhibition of brassinosteroid biosynthetic genes. May act as transcriptional repressor by binding the brassinosteroid-response element (5'-CGTGCG-3') in the promoter of GRAS32 (AC Q9LWU9), another positive regulator of brassinosteroid signaling. {ECO:0000269|PubMed:17699623, ECO:0000269|PubMed:19220793}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00073ChIP-chipTransfer from AT1G19350Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g39220.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g39220
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1067480.0AK106748.1 Oryza sativa Japonica Group cDNA clone:002-115-C06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645123.10.0PREDICTED: protein BZR1 homolog 1
SwissprotQ7XI960.0BZR1_ORYSJ; Protein BZR1 homolog 1
SwissprotB8B7S50.0BZR1_ORYSI; Protein BZR1 homolog 1
TrEMBLA0A0E0QAC11e-175A0A0E0QAC1_ORYRU; Uncharacterized protein
TrEMBLI1QEM41e-175I1QEM4_ORYGL; Uncharacterized protein
STRINGBGIOSGA024018-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os07g39220.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP37191024
MonocotsOGMP54743453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.32e-80BES1 family protein
Publications ? help Back to Top
  1. Bai MY, et al.
    Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(34): p. 13839-44
    [PMID:17699623]
  2. Tong H, et al.
    DWARF AND LOW-TILLERING, a new member of the GRAS family, plays positive roles in brassinosteroid signaling in rice.
    Plant J., 2009. 58(5): p. 803-16
    [PMID:19220793]