PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g38030.1
Common NameLOC4343637, Os07g0567700, OSNPB_070567700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 458aa    MW: 49096.6 Da    PI: 5.5968
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g38030.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3611.7e-110694342374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        +lLl+cAeav+ ++l +a+ lL ++ elasp g++ +R+aayf  AL ar+++s  + y+ l+ ++ +  +s +   a+++++ +sP++kfs
  LOC_Os07g38030.1  69 LSLLLRCAEAVAMDQLPEARDLLPEIAELASPFGSSPERVAAYFGDALCARVLSSYLGAYSPLALRPLAAAQSRRISGAFQAYNALSPLVKFS 161
                       689******************************************************************999********************* PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle 187
                       h+taNqaI +a++ge+rvH+iD+di+qGlQWp L++ LasRp +p slRiTg+g+    s + le+tg+rLa+fA++lg+pfef+++  k  +
  LOC_Os07g38030.1 162 HFTANQAIFQALDGEDRVHVIDLDIMQGLQWPGLFHILASRPTKPRSLRITGLGA----SLDVLEATGRRLADFAASLGLPFEFRPIEGKIGH 250
                       *******************************************************....9**************************7666555 PP

              GRAS 188 dleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                         +  +L   +  gEa++V++++  h l+d ++s +     +++l+ksl+Pk++++veq++ h s++Fl rf+eal+yysalfd+l  +++++
  LOC_Os07g38030.1 251 VADAAALLGPRhhGEATVVHWMH--HCLYDVTGSDAG----TVRLLKSLRPKLITIVEQDLGH-SGDFLGRFVEALHYYSALFDALGDGAGAA 336
                       5566666443358*********9..888888888888....**********************.899*******************5443333 PP

              GRAS 279 s...eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLv 368
                       +    er+ vEr+llg ei+n+va  g +r+ + + +e+W + l++aGF+pv+l  + a+qa+lll +++++gy++ ee+g+l lgWkd +L+
  LOC_Os07g38030.1 337 EeeaAERHAVERQLLGAEIRNIVAVGGPKRTGEVR-VERWGDELRRAGFRPVTLAGSPAAQARLLLGMYPWKGYTLVEEDGCLKLGWKDLSLL 428
                       323699***********************998887.9******************************************************** PP

              GRAS 369 svSaWr 374
                       ++S+W+
  LOC_Os07g38030.1 429 TASSWE 434
                       *****5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.63842414IPR005202Transcription factor GRAS
PfamPF035145.9E-10869434IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MLQGVLSRAP GADAAAMKAK RAADDEEEGG ERERARGKRL AAEGKQGLVV VSTGEEEEAA  60
AETRGLRLLS LLLRCAEAVA MDQLPEARDL LPEIAELASP FGSSPERVAA YFGDALCARV  120
LSSYLGAYSP LALRPLAAAQ SRRISGAFQA YNALSPLVKF SHFTANQAIF QALDGEDRVH  180
VIDLDIMQGL QWPGLFHILA SRPTKPRSLR ITGLGASLDV LEATGRRLAD FAASLGLPFE  240
FRPIEGKIGH VADAAALLGP RHHGEATVVH WMHHCLYDVT GSDAGTVRLL KSLRPKLITI  300
VEQDLGHSGD FLGRFVEALH YYSALFDALG DGAGAAEEEA AERHAVERQL LGAEIRNIVA  360
VGGPKRTGEV RVERWGDELR RAGFRPVTLA GSPAAQARLL LGMYPWKGYT LVEEDGCLKL  420
GWKDLSLLTA SSWEPTDGDA DADVAVAGDT HHESHDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-49684334374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.370320.0flower| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379897630.0
Expression AtlasA0A0P0X7S9-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g38030.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g38030
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0038660.0AP003866.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1092_A07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644982.10.0PREDICTED: scarecrow-like protein 23
SwissprotQ9FHZ11e-173SCL23_ARATH; Scarecrow-like protein 23
TrEMBLA0A0E0I2G60.0A0A0E0I2G6_ORYNI; Uncharacterized protein
TrEMBLA0A0E0QA150.0A0A0E0QA15_ORYRU; Uncharacterized protein
TrEMBLA0A0P0X7S90.0A0A0P0X7S9_ORYSJ; Os07g0567700 protein
STRINGLOC_Os07g38030.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP21831437
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.11e-155GRAS family protein