PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g37920.1
Common NameLOC4343630, OJ1092_A07.104, OJ1773_H01.126, ONAC010, Os07g0566500, OsJ_24777
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 426aa    MW: 45096.3 Da    PI: 7.3237
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g37920.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.71.3e-54291571128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++PwdLp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+++
  LOC_Os07g37920.1  29 LPPGFRFHPTDEELVVHYLKKKAASVPLPV-TIIAEVDLYKFDPWDLPEKANFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPIM 120
                       79****************************.89***************99999**************************************** PP

               NAM  94 sk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s+  ++e+vg+kk Lvfy+g+ pkg+kt+W+mheyrl
  LOC_Os07g37920.1 121 SSgsTREKVGVKKALVFYRGKPPKGVKTNWIMHEYRL 157
                       *9777788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-6425200IPR003441NAC domain
PROSITE profilePS5100561.88929200IPR003441NAC domain
PfamPF023658.2E-2830157IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009071anatomyanther wall tapetum
PO:0001013developmental stageH late unicellular microspore stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MESPDSSSGS APPRVLRRQQ QQPGSAPELP PGFRFHPTDE ELVVHYLKKK AASVPLPVTI  60
IAEVDLYKFD PWDLPEKANF GEQEWYFFSP RDRKYPNGAR PNRAATSGYW KATGTDKPIM  120
SSGSTREKVG VKKALVFYRG KPPKGVKTNW IMHEYRLTDT SSSAAAVATT RRPPPPITGG  180
SKGAVSLRLD DWVLCRIYKK TNKAGAGQRS MECEDSVEDA VAAYAPSSQQ HATAAAGMAG  240
SDGAGGVAAA HGGDYSSLLH HDSHEDTFLV NGLLTAEDAA GLSTGASSLS QLAAAARAAA  300
TPCDATKQLL APSPTPFNWF EAFLPRAKEF PSGLSRSSRD IGDMSLSSTV DRSLSEAGAV  360
AIDTGDAANG ANTMPAFINP LGVQGATYQQ HQAIMGASLP SESAAAAAAC NFQHPFQLSR  420
VNWDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-75182034171Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.364370.0callus| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329734240.0
Expression AtlasQ8H4S4-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during anther and flower development and leaf senescence. {ECO:0000269|PubMed:22278768}.
UniprotTISSUE SPECIFICITY: Highest expression in stamens. Expressed in leaves. {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:22278768}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with male fertility. Involved in anther development, but not in senescence. Reduced expression of NAC5 via RNAi leads to male-sterility. {ECO:0000269|PubMed:22278768}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g37920.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, salt and cold treatments. {ECO:0000269|PubMed:18813954}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g37920
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0634060.0AK063406.1 Oryza sativa Japonica Group cDNA clone:001-115-A08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645677.10.0PREDICTED: NAC transcription factor ONAC010
SwissprotQ8H4S40.0NAC10_ORYSJ; NAC transcription factor ONAC010
TrEMBLA0A0E0QA050.0A0A0E0QA05_ORYRU; Uncharacterized protein
STRINGLOC_Os07g37920.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP75723649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.12e-88NAC domain containing protein 25
Publications ? help Back to Top
  1. Fang Y,You J,Xie K,Xie W,Xiong L
    Systematic sequence analysis and identification of tissue-specific or stress-responsive genes of NAC transcription factor family in rice.
    Mol. Genet. Genomics, 2008. 280(6): p. 547-63
    [PMID:18813954]
  2. Distelfeld A, et al.
    Divergent functions of orthologous NAC transcription factors in wheat and rice.
    Plant Mol. Biol., 2012. 78(4-5): p. 515-24
    [PMID:22278768]