PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g37630.1
Common NameLOC4343610, OJ1720_F04.111, Os07g0563600, OSNPB_070563600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family FAR1
Protein Properties Length: 904aa    MW: 101999 Da    PI: 7.2863
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g37630.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1872.7e-27116203190
              FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                       +fYn+YA++vGF vr+s+  ++++n  it+rtfvCs+eg+re+++ + ++++ +r+etr+gC a+++++++++gk+++t+++ +HnH+la
  LOC_Os07g37630.1 116 DFYNAYAEMVGFFVRRSTLWTTSKNI-ITRRTFVCSREGFREKKRGT-KEAKCPRPETRIGCPASMTIRLNTNGKYRLTEFVPNHNHQLA 203
                       6********************97766.****************9988.99**************************************97 PP

2FAR183.82.7e-26245331189
              FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                       +fY+ YA ++GF+vr+++++ +  ++ it+r fvCskeg+re+++ + ++ +++r+etrtgC a+++++++++gk++vt++++ HnH+l
  LOC_Os07g37630.1 245 EFYSMYAGKIGFNVRRASMTMN-AENVITRRMFVCSKEGFREKKRGA-KRVKKPRPETRTGCPACMVIRLTSNGKYHVTEFVTFHNHQL 331
                       6*****************9999.5556****************9998.99*************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.1E-24116203IPR004330FAR1 DNA binding domain
PfamPF031011.5E-22245331IPR004330FAR1 DNA binding domain
PfamPF105518.3E-25448542IPR018289MULE transposase domain
PfamPF044349.4E-9716762IPR007527Zinc finger, SWIM-type
PROSITE profilePS5096610.843716763IPR007527Zinc finger, SWIM-type
SMARTSM005751.0E-6738765IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000032anatomytetrad of microspores
PO:0001029developmental stageE tetrad stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 904 aa     Download sequence    Send to blast
MSSNSGGSAK EKDPENAPEL VALPLVRTLR PVHAVIDPAA DPRSAQLSWP GHVVLLPPYA  60
TWPHHVPTLP PAVNPANPQQ NVDVAAADVS PDVGCCDEKM LPKVDMLFDG EKEAYDFYNA  120
YAEMVGFFVR RSTLWTTSKN IITRRTFVCS REGFREKKRG TKEAKCPRPE TRIGCPASMT  180
IRLNTNGKYR LTEFVPNHNH QLATASTMHM LKAKKIRLKA RAARENLVDD TVRTPEFGSE  240
DEAYEFYSMY AGKIGFNVRR ASMTMNAENV ITRRMFVCSK EGFREKKRGA KRVKKPRPET  300
RTGCPACMVI RLTSNGKYHV TEFVTFHNHQ LGATVPSDLV ATSQSTETGQ DDGLDLVDGS  360
ADANIHRQNL IIGNIMATSL EGRSNKRFKC TKVPHYGDVG ATLEYLQKMQ HDNPSFFFAV  420
KSDDDGNLTN FLWSDSKSIM DFVHFGDVVC LDSTYALQGY GRPLALFTGV NHHKQTVIFA  480
AALLYDESVE AFRWLFDTFK MAMNGTQPKT LLTDRSDAIS EGVAASWPAT AHRYCVWQIY  540
QNALQQLSQA FHGSKTLDYC FQKCLFDSED EPEFLTAWRE MLEKYDLEDN QWLADLFSLK  600
EKWALPYGRE AFCADMKSVQ QKESLGTELK KHLSLEFDLL SFFKQFERVL CDRRSTELQA  660
DVDASQSTKK PPPMRVLRQA SNIYTPAAFK MFEREFELYM DCMLYNCGEM GTISEYRVVI  720
EDNPKDHFVK FDSLNSMVNC SCKGFEFVGI PCRHMLKVLD TRNIKDLPPQ YFLKRWRKDA  780
KSGSPNCSYS FPLDGDPQLV QTKRYNLLCR MFSIAAARAA TSIETFAYME NQSSIFMDQV  840
EQALQTRPPD IAAMIGAHCD QTQNPIDNIV AGGLHSHTNF INGPADGSLT FPFTLGAGVL  900
DYR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.256400.0callus| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329775930.0
Expression AtlasQ8H344-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g37630.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g37630
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0675750.0AK067575.1 Oryza sativa Japonica Group cDNA clone:J013110M05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647776.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5
TrEMBLQ8H3440.0Q8H344_ORYSJ; Os07g0563600 protein
STRINGLOC_Os07g37630.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1397544
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-112FAR1-related sequence 5