PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g37210.1
Common NameLOC4343580, Os07g0558100, OSNPB_070558100, P0567H04.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 369aa    MW: 39929 Da    PI: 7.0918
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g37210.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.51.7e-191461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEde+l+ ++k++G g+W+t ++  g+ R++k+c++rw +yl
  LOC_Os07g37210.1 14 KGPWTPEEDEKLIAYIKEHGQGNWRTLPKNAGLSRCGKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding54.42.9e-1767111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
  LOC_Os07g37210.1  67 RGRFSFEEEEAIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                       89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.645965IPR017930Myb domain
SuperFamilySSF466899.9E-3211108IPR009057Homeodomain-like
SMARTSM007175.3E-171363IPR001005SANT/Myb domain
PfamPF002493.0E-171461IPR001005SANT/Myb domain
CDDcd001671.25E-131661No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129420.76866116IPR017930Myb domain
SMARTSM007178.3E-1766114IPR001005SANT/Myb domain
PfamPF002491.8E-1567111IPR001005SANT/Myb domain
CDDcd001671.08E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001059developmental stageJ bicellular pollen stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MGRAPCCEKS GLKKGPWTPE EDEKLIAYIK EHGQGNWRTL PKNAGLSRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEEAIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHAPRL DLLDLTSLLK PAAAAAYYPT QADLDTLRAL EPLAGYPDLL RLASAILPAA  180
TTTGAAAAAA AEQAQLLLPW LLQAQMAQQQ QQVTPPPPPP PQAAATEQFL QATSTACHQM  240
PGLVHASPTQ QLAQQPQDHM AAATCHRRGA VQHPSYDNQL DYVPALMQMA SDASNLQQWS  300
STVSSSNNHN VNSGVSTPSS SPAAAGQINS SSTTTTTTYG LNASGDVDDA GLLINMHLSE  360
LLDVSDYM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-31121165108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO19462660.0
Expression AtlasQ6Z414-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g37210.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g37210
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankY114150.0Y11415.1 O.sativa mRNA for myb factor, 1355 bp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645522.10.0PREDICTED: transcription factor MYB39
SwissprotQ8GWP01e-74MYB39_ARATH; Transcription factor MYB39
TrEMBLQ6Z4140.0Q6Z414_ORYSJ; Myb protein
STRINGLOC_Os07g37210.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-86MYB-like 102
Publications ? help Back to Top
  1. NA
    The electronic Plant Gene Register.
    Plant Physiol., 1997. 114(1): p. 395-6
    [PMID:9159957]