PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g36170.2
Common NameCIGR1, LOC4343521, Os07g0545800, OsJ_24639, P0006G05.102
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 572aa    MW: 64602.2 Da    PI: 6.1758
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g36170.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS415.54.6e-1272025702373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL++cAea+s++ +e+ ++l+++ +  +s +g+p+qRl ay++e+L ar  +s++++y+al+++e +   s+e l++++++++++P++kf+
  LOC_Os07g36170.2 202 KQLLTRCAEALSEDRTEEFHKLVQEARGVVSINGEPIQRLGAYLLEGLVARHGNSGTNIYRALKCREPE---SKELLSYMRILYNICPYFKFG 291
                       689*****************************************************************9...9******************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +++aN aI ea+ +e+ +HiiDf+i qG+QW++L+qaLa+Rp+gpp++RiTg+++p s+  + e l  +g+ L+++ ee+++p+ef++l +  
  LOC_Os07g36170.2 292 YMAANGAIAEALRTENNIHIIDFQIAQGTQWITLIQALAARPGGPPRVRITGIDDPVSEyaRGEGLDIVGKMLKSMSEEFKIPLEFTPL-SVY 383
                       ********************************************************999999**************************6.788 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                        ++++ e+L+++pgEal Vn+ lqlh+++desv+++++rd +L++vk+lsPkv ++veqe+ +n+++Fl rf e++eyysa+f+s++a+lpr+
  LOC_Os07g36170.2 384 ATQVTKEMLEIRPGEALSVNFTLQLHHTPDESVDVNNPRDGLLRMVKGLSPKVTTLVEQESHTNTTPFLMRFGETMEYYSAMFESIDANLPRD 476
                       99999**************************************************************************************** PP

              GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                       ++eri+vE+++l+++ivn++aceg++r+erhe l+kW++rl++aGF+p+pls+++++ ++ ll+ ++ d y+++e++g+++lgW++r+L+s+S
  LOC_Os07g36170.2 477 NKERISVEQHCLAKDIVNIIACEGKDRVERHELLGKWKSRLTMAGFRPYPLSSYVNSVIRKLLACYS-DKYTLDEKDGAMLLGWRSRKLISAS 568
                       ***************************************************************9999.55*********************** PP

              GRAS 372 aW 373
                       aW
  LOC_Os07g36170.2 569 AW 570
                       ** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.034175552IPR005202Transcription factor GRAS
PfamPF035141.6E-124202570IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MDLHQLLKYR LTGANVVYEI PTENNLQNSP WQANPLKYEF SDSPYTPLSS QFECDNLSAL  60
TNTPDNQSST ETISAQPISP LEADSSYRQA GILLQENIQV GADPLYATSR HNMQHALREI  120
ETVLMAPDTD DATTSTKHEF EEIKPAQLVR QRSRTWSHES RQPLPGVGRS QFASGGYPTA  180
SYEFRPEKRQ RELREDPQII VKQLLTRCAE ALSEDRTEEF HKLVQEARGV VSINGEPIQR  240
LGAYLLEGLV ARHGNSGTNI YRALKCREPE SKELLSYMRI LYNICPYFKF GYMAANGAIA  300
EALRTENNIH IIDFQIAQGT QWITLIQALA ARPGGPPRVR ITGIDDPVSE YARGEGLDIV  360
GKMLKSMSEE FKIPLEFTPL SVYATQVTKE MLEIRPGEAL SVNFTLQLHH TPDESVDVNN  420
PRDGLLRMVK GLSPKVTTLV EQESHTNTTP FLMRFGETME YYSAMFESID ANLPRDNKER  480
ISVEQHCLAK DIVNIIACEG KDRVERHELL GKWKSRLTMA GFRPYPLSSY VNSVIRKLLA  540
CYSDKYTLDE KDGAMLLGWR SRKLISASAW H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-612015714375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.94820.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329792900.0
Expression AtlasQ69VG1-
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g36170.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g36170
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0042350.0AP004235.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0006G05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646796.10.0PREDICTED: chitin-inducible gibberellin-responsive protein 1
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLA0A0E0Q9K20.0A0A0E0Q9K2_ORYRU; Uncharacterized protein
STRINGLOC_Os07g36170.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Day RB,Shibuya N,Minami E
    Identification and characterization of two new members of the GRAS gene family in rice responsive to N-acetylchitooligosaccharide elicitor.
    Biochim. Biophys. Acta, 2003. 1625(3): p. 261-8
    [PMID:12591613]