PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g34880.1
Common NameOs07g0533100, OsJ_023594, OSJNBa0039D04.15, WOX13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WOX
Protein Properties Length: 307aa    MW: 33095.7 Da    PI: 12.1475
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g34880.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.53.5e-16134194257
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                       ++R+++ +eq+++Le+ F++   +p ++e+ ++ ++l    ++ +++V++WFqNr+ + k+
  LOC_Os07g34880.1 134 KPRRNPRPEQIRILEAIFNSgMVNPPRDEIPRIRMQLqeygQVGDANVFYWFQNRKSRSKN 194
                       89*****************99*************************************995 PP

2Wus_type_Homeobox105.82.7e-34133195264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++R +P+peQi+iLe++++sG+++P+++ei ri+++L+eyG+++d+NVfyWFQNrk+R+++k
   LOC_Os07g34880.1 133 PKPRRNPRPEQIRILEAIFNSGMVNPPRDEIPRIRMQLQEYGQVGDANVFYWFQNRKSRSKNK 195
                        578**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.284130195IPR001356Homeobox domain
SuperFamilySSF466895.56E-11132196IPR009057Homeodomain-like
SMARTSM003893.4E-6132199IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.0E-7133197IPR009057Homeodomain-like
CDDcd000861.10E-6133195No hitNo description
PfamPF000467.7E-14134193IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MMALGVPPPP SRAYVSGPLR DDDTFGGDRV RRRRRWLKEQ CPAIIVHGGG RRGGVGHRAL  60
AAGVSKMRLP ALNAATHRIP STSPLSIPQT LTITRDPPYP MLPRSHGHRT GGGGFSLKSS  120
PFSSVGEERV PDPKPRRNPR PEQIRILEAI FNSGMVNPPR DEIPRIRMQL QEYGQVGDAN  180
VFYWFQNRKS RSKNKLRSGG TGRAGLGLGG NRASEPPAAA TAHREAVAPS FTPPPILPPQ  240
PVQPQQQLVS PVAAPTSLSS SSSDRSSGSS KPARATLTQA MSVTAAMDLL SPLRRSARPR  300
QEQRHV*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasA3BKM2
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g34880.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g34880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0067530.0AP006753.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OSJNBa0039D04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646013.11e-138PREDICTED: WUSCHEL-related homeobox 13-like
SwissprotA3BKM20.0WOX13_ORYSJ; WUSCHEL-related homeobox 13
TrEMBLA0A0E0ECF40.0A0A0E0ECF4_9ORYZ; Uncharacterized protein
STRINGLOC_Os07g34880.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP61031220
MonocotsOGMP26663470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.12e-39homeobox-3
Publications ? help Back to Top
  1. Nardmann J,Werr W
    The shoot stem cell niche in angiosperms: expression patterns of WUS orthologues in rice and maize imply major modifications in the course of mono- and dicot evolution.
    Mol. Biol. Evol., 2006. 23(12): p. 2492-504
    [PMID:16987950]