PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g32510.1
Common NameLOC4343343, OJ1163_G04.119, Os07g0508900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 360aa    MW: 34259.9 Da    PI: 8.0653
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g32510.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.7e-3946105362
            zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +al+cprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+s+
  LOC_Os07g32510.1  46 AEALRCPRCDSANTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRSR 105
                       57899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-3142102IPR003851Zinc finger, Dof-type
PfamPF027011.7E-3348103IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.38549103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MAGAGGAATA AAGGGGGGGV AAGRSGGGGG GGAAAAAGAG APDPRAEALR CPRCDSANTK  60
FCYYNNYSLS QPRHFCKACK RYWTRGGTLR NVPVGGGCRK NKRSRSGGAA PGGGVGRGGP  120
GGGAAAAVSS AGGGAAGTSP ASSLALPQPG SLPSLSSALG LTGGTSLASL LLGSGGSGGD  180
HLGLFQAMQS VVSDAAAFEM HQQHQSQVDH LLGLGYGAAG AQIQAAKPWL HDGGATGGLL  240
DGFYAPLLSG SIVPGLEELQ VKAEATTGDH QQKSSAAAAG EQSWDLPTPS SSNVEASIIA  300
SDALMAAAAA SMNPAVSAAA ASTAPSAQSL LYWGNGGIGA AAAAWPDLAN CGSSIATLF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.586430.0callus| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154722940.0
Expression AtlasQ8LIJ0-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g32510.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g32510
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0038150.0AP003815.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1163_G04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647864.10.0PREDICTED: dof zinc finger protein DOF5.4
TrEMBLA0A0E0I1S80.0A0A0E0I1S8_ORYNI; Uncharacterized protein
TrEMBLQ8LIJ00.0Q8LIJ0_ORYSJ; Os07g0508900 protein
STRINGLOC_Os07g32510.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP88953041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.17e-34TARGET OF MONOPTEROS 6