PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g32170.1
Common NameLOC9270355, Os07g0505200, P0430F03.47, SPL13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SBP
Protein Properties Length: 217aa    MW: 22044.3 Da    PI: 10.8356
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g32170.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.72.5e-41109186178
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       +Cqve+C +dlsea +y+rrhkvC++hsk pvvlv+gl+qrfCqqCsrfhel+efD++krsCrrrLa+hnerrrk++a
  LOC_Os07g32170.1 109 RCQVERCGVDLSEAGRYNRRHKVCQTHSKEPVVLVAGLRQRFCQQCSRFHELTEFDDAKRSCRRRLAGHNERRRKSAA 186
                       6**************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.3E-34103171IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.351107184IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.1E-38108188IPR004333Transcription factor, SBP-box
PfamPF031101.2E-31110183IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MDRKDKARKN FSSSSSSSAA SMAALAAAAA AGDGGAALPS PMEEDKKPRL VASSLAPVAG  60
GGGGGSSSSA AVAAGASSSS SSSSVAAAAR RGAGRAGGGA PSGGGGGPRC QVERCGVDLS  120
EAGRYNRRHK VCQTHSKEPV VLVAGLRQRF CQQCSRFHEL TEFDDAKRSC RRRLAGHNER  180
RRKSAADTAH GENCRHADQD AGRSHQGTGN PPFQIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-36102183384squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.775500.0panicle
Os.789100.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567646820.0
Expression AtlasQ6Z461-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g32170.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g32170
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8995810.0KT899581.1 Oryza sativa Japonica Group isolate Dongjing GLW7 (GLW7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645415.11e-151PREDICTED: squamosa promoter-binding-like protein 13
SwissprotQ6Z4611e-153SPL13_ORYSJ; Squamosa promoter-binding-like protein 13
TrEMBLA0A0E0I1A61e-151A0A0E0I1A6_ORYNI; Uncharacterized protein
TrEMBLA0A0E0Q8R11e-151A0A0E0Q8R1_ORYRU; Uncharacterized protein
TrEMBLB8B6F81e-151B8B6F8_ORYSI; Putative uncharacterized protein
TrEMBLC7J4X61e-151C7J4X6_ORYSJ; GLW7
STRINGBGIOSGA024253-PA1e-150(Oryza sativa Indica Group)
STRINGLOC_Os07g32170.11e-150(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
MonocotsOGMP85243248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.22e-37squamosa promoter binding protein-like 4
Publications ? help Back to Top
  1. Xie K,Wu C,Xiong L
    Genomic organization, differential expression, and interaction of SQUAMOSA promoter-binding-like transcription factors and microRNA156 in rice.
    Plant Physiol., 2006. 142(1): p. 280-93
    [PMID:16861571]
  2. Yang Z, et al.
    Comparative study of SBP-box gene family in Arabidopsis and rice.
    Gene, 2008. 407(1-2): p. 1-11
    [PMID:17629421]