PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g31470.1
Common NameLOC4343302, OJ1197_D06.104, Os07g0497500, OsJ_24340, OSNPB_070497500, P0005E02.111
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 401aa    MW: 41655.9 Da    PI: 6.8912
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g31470.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.9e-181360148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg W++eEde+lv+++ ++G  +W++++++ g+ R++k+c++rw +yl
  LOC_Os07g31470.1 13 RGLWSPEEDEKLVRYISEHGHSCWSSVPKHAGLQRCGKSCRLRWINYL 60
                      788*******************************************97 PP

2Myb_DNA-binding50.54.8e-1666109146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg ++++E+  ++d+++ lG++ W+ Ia++++ gRt++++k++w++
  LOC_Os07g31470.1  66 RGTFSEQEERTIIDVHRILGNR-WAQIAKHLP-GRTDNEVKNFWNS 109
                       899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-27463IPR009057Homeodomain-like
PROSITE profilePS5129419.005860IPR017930Myb domain
SuperFamilySSF466891.24E-2810107IPR009057Homeodomain-like
SMARTSM007171.9E-141262IPR001005SANT/Myb domain
PfamPF002491.1E-161360IPR001005SANT/Myb domain
CDDcd001677.74E-131660No hitNo description
PROSITE profilePS5129425.59761115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2464116IPR009057Homeodomain-like
SMARTSM007171.4E-1565113IPR001005SANT/Myb domain
PfamPF002498.5E-1566109IPR001005SANT/Myb domain
CDDcd001671.36E-1168108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MGHHCCSKQK VKRGLWSPEE DEKLVRYISE HGHSCWSSVP KHAGLQRCGK SCRLRWINYL  60
RPDLKRGTFS EQEERTIIDV HRILGNRWAQ IAKHLPGRTD NEVKNFWNSC IKKKLIAQGL  120
DPKTHNLLPA SKTLLHGGGG GGAANPSGNG LAQFQSNNGA AAAGTTPFTI SSPAKAAAYD  180
VAPPALYDVV LPANPAGGML MAHDHHHHHQ VAAAAAPVGY PYADHGGNGG GVLMSFRDQN  240
AGVHGAASMD FMNGSSSSSS MEQLGGGGGM SSNGNGSFSA SMAAFMDEEA AMWATAVAPP  300
GMGGLAGMDQ VAQQQQQQQV LVQDAAVGVA PTTLMMHGGG AATAGAMVVD KSVEMVDVSS  360
AVYGGATATA FDLDLMVESC GMFCGGGGAG NAMEQLQWDC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-34131157108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154722180.0
Expression AtlasQ7F0R0-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g31470.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g31470
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0042590.0AP004259.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0005E02.
GenBankAP0040060.0AP004006.5 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1197_D06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645809.10.0PREDICTED: myb-related protein Hv33
TrEMBLA0A0E0Q8L40.0A0A0E0Q8L4_ORYRU; Uncharacterized protein
TrEMBLQ7F0R00.0Q7F0R0_ORYSJ; Os07g0497500 protein
STRINGLOC_Os07g31470.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP97513545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.12e-82myb domain protein 67