PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g30130.1
Common NameLOC4343245, Os07g0484700, OSNPB_070484700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 168aa    MW: 18223.5 Da    PI: 10.6866
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g30130.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-1690137148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT+eEd+ l+ +++++G+g+W++++   g  R+ k+c++rw +yl
  LOC_Os07g30130.1  90 KGPWTPEEDLMLASYIQEHGSGNWRAVPTNTGVMRCSKSCRLRWTNYL 137
                       79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-2188140IPR009057Homeodomain-like
PROSITE profilePS5129419.75188141IPR017930Myb domain
SMARTSM007171.3E-1289139IPR001005SANT/Myb domain
PfamPF002491.4E-1690137IPR001005SANT/Myb domain
SuperFamilySSF466894.9E-2291164IPR009057Homeodomain-like
CDDcd001671.10E-1192137No hitNo description
Gene3DG3DSA:1.10.10.607.8E-7141164IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MPDQRRGTTA LLPTARHGPA ASDRHHSASA ARRDAAATRP ATSVAAANTL VSSSLIEIES  60
THTPPTTGRP PRTGEQDGEA AVLRQGWVKK GPWTPEEDLM LASYIQEHGS GNWRAVPTNT  120
GVMRCSKSCR LRWTNYLRPG IKRGNFTEQE EKLIVHLQAL LGNRSLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-1390164780B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.267080.0leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329760430.0
Expression AtlasQ0D6F7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g30130.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g30130
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0660250.0AK066025.1 Oryza sativa Japonica Group cDNA clone:J013044E03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647840.11e-120PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647838.11e-120PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647837.11e-120PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647836.11e-120PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647835.11e-120PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647834.11e-120PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647833.11e-120PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647832.11e-120PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647831.11e-120PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647830.11e-120PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647829.11e-120PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647828.11e-120PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647827.11e-120PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647826.11e-120PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647825.11e-120PREDICTED: transcription factor MYB21 isoform X1
TrEMBLQ0D6F71e-120Q0D6F7_ORYSJ; Os07g0484700 protein
STRINGLOC_Os07g30130.11e-120(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP4047523
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.11e-48myb domain protein 30