PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g28430.1
Common NameGRF11, LOC4343178, Os07g0467500, OsJ_24174, P0003B09.18
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRF
Protein Properties Length: 270aa    MW: 28001 Da    PI: 4.4802
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g28430.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC73.81.9e-23180224145
               WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                       ++epgrCrRtDGKkWRC+r++++++k+CErH+hrgr+r  + ++e
  LOC_Os07g28430.1 180 EPEPGRCRRTDGKKWRCWRNAIANEKYCERHMHRGRKRPVQLVVE 224
                       69************************************9998875 PP

2QLQ54.34.2e-19114149237
               QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                       aFTa+Qlq+L++Q  +y+y+aa++PvP +L+++i+k
  LOC_Os07g28430.1 114 AFTAMQLQELEQQSRVYQYMAARVPVPTHLVFPIWK 149
                       8*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.7E-8113149IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.4E-12114148IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.922114149IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.302180224IPR014977WRC domain
PfamPF088791.3E-19181219IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MAAEGEAKKD SASNPPGGGG GGGGGEEEED SSLAVGEAAV GVGEAGGGGG GGEKADREEE  60
EGKEDVEEGG VCKDLVLVED AVPVEDPEEA AATAALQEEM KALVESVPVG AGAAFTAMQL  120
QELEQQSRVY QYMAARVPVP THLVFPIWKS VTGASSEGAQ KYPTLMGLAT LCLDFGKNPE  180
PEPGRCRRTD GKKWRCWRNA IANEKYCERH MHRGRKRPVQ LVVEDDEPDS TSGSKPASGK  240
ATEGGKKTDD KSSSSKKLAV AAPAAVEST*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.53290.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329764180.0
Expression AtlasQ6AWX8-
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g28430.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g28430
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0664000.0AK066400.1 Oryza sativa Japonica Group cDNA clone:J013062O07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644678.10.0PREDICTED: growth-regulating factor 11
SwissprotQ6AWX80.0GRF11_ORYSJ; Growth-regulating factor 11
TrEMBLA0A0E0I0C20.0A0A0E0I0C2_ORYNI; Uncharacterized protein
TrEMBLA2YL380.0A2YL38_ORYSI; Putative uncharacterized protein
STRINGLOC_Os07g28430.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA025662-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1193646
MonocotsOGMP67353152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-29growth-regulating factor 5
Publications ? help Back to Top
  1. Choi D,Kim JH,Kende H
    Whole genome analysis of the OsGRF gene family encoding plant-specific putative transcription activators in rice (Oryza sativa L.).
    Plant Cell Physiol., 2004. 45(7): p. 897-904
    [PMID:15295073]