PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g25710.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 427aa    MW: 46282.1 Da    PI: 5.1625
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g25710.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.31.5e-32246300155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       k+r+rWtpeLHerFv+av+ LGGsekAtPk +l+lmk + Lt++hvkSHLQkYR+
  LOC_Os07g25710.2 246 KTRMRWTPELHERFVDAVNLLGGSEKATPKGVLKLMKADNLTIYHVKSHLQKYRT 300
                       68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-30243302IPR009057Homeodomain-like
PROSITE profilePS5129413.059243303IPR017930Myb domain
SuperFamilySSF466891.97E-17245300IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-24246300IPR006447Myb domain, plants
PfamPF002494.1E-10248299IPR001005SANT/Myb domain
PfamPF143791.2E-21333377IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MERISTNQLY NSGIPVTVPS PLPAIPATLD ENIPRIPDGQ NVPRERELRS TPMPPHQNQS  60
TVAPLHGHFQ SSTGSVGPLR SSQAIRFSSV SSNEQYTNAN PYNSQPPSSG SSSTLNYGSQ  120
YGGFEPSLTD FPRDAGPTWC PDPVDGLLGY TDDVPAGNNL TENSSIAAGD ELAKQSEWWN  180
DFMNYDWKDI DNTACTETQP QVGPAAQSSV AVHQSAAQQS VSSQSGEPSA VAIPSPSGAS  240
NTSNSKTRMR WTPELHERFV DAVNLLGGSE KATPKGVLKL MKADNLTIYH VKSHLQKYRT  300
ARYRPELSEG SSEKKAASKE DIPSIDLKGG NFDLTEALRL QLELQKRLHE QLEIQRSLQL  360
RIEEQGKCLQ MMLEQQCIPG TDKAVDASTS AEGTKPSSDL PESSAVKDVP ENSQNGIAKQ  420
TGMRIH*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.280620.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329852740.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g25710.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g25710
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1000650.0AK100065.1 Oryza sativa Japonica Group cDNA clone:J013160O05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647736.10.0PREDICTED: protein PHR1-LIKE 1
RefseqXP_015647735.10.0PREDICTED: protein PHR1-LIKE 1
SwissprotQ8GUN51e-60PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLB9FWZ10.0B9FWZ1_ORYSJ; Uncharacterized protein
TrEMBLI1QAB30.0I1QAB3_ORYGL; Uncharacterized protein
STRINGORGLA07G0105500.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.18e-63phosphate starvation response 1