PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g25710.1
Common NameLOC4343086, Os07g0438800, OSJNBa0026I22.19, P0443H10.4, PHR2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 427aa    MW: 46231.9 Da    PI: 4.8929
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g25710.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.31.5e-32246300155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       k+r+rWtpeLHerFv+av+ LGGsekAtPk +l+lmk + Lt++hvkSHLQkYR+
  LOC_Os07g25710.1 246 KTRMRWTPELHERFVDAVNLLGGSEKATPKGVLKLMKADNLTIYHVKSHLQKYRT 300
                       68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-30243302IPR009057Homeodomain-like
PROSITE profilePS5129413.059243303IPR017930Myb domain
SuperFamilySSF466891.97E-17245300IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-24246300IPR006447Myb domain, plants
PfamPF002494.1E-10248299IPR001005SANT/Myb domain
PfamPF143791.2E-21333377IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MERISTNQLY NSGIPVTVPS PLPAIPATLD ENIPRIPDGQ NVPRERELRS TPMPPHQNQS  60
TVAPLHGHFQ SSTGSVGPLR SSQAIRFSSV SSNEQYTNAN PYNSQPPSSG SSSTLNYGSQ  120
YGGFEPSLTD FPRDAGPTWC PDPVDGLLGY TDDVPAGNNL TENSSIAAGD ELAKQSEWWN  180
DFMNYDWKDI DNTACTETQP QVGPAAQSSV AVHQSAAQQS VSSQSGEPSA VAIPSPSGAS  240
NTSNSKTRMR WTPELHERFV DAVNLLGGSE KATPKGVLKL MKADNLTIYH VKSHLQKYRT  300
ARYRPELSEG SSEKKAASKE DIPSIDLKGG NFDLTEALRL QLELQKRLHE QLEIQRSLQL  360
RIEEQGKCLQ MMLEQQCIPG TDKAVDASTS AEGTKPSSDL PESSAVKDVP ENSQNGIAKQ  420
TESGDR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.280620.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329852740.0
Expression AtlasQ6Z156-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed throughout all stages of plant growth. {ECO:0000269|PubMed:26082401}.
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and fruits (PubMed:18263782). Expressed in the root cap and in the exodermis, sclerenchyma and vascular tissues of the root, in the cortex cells and the stele of lateral roots, in the mesophyll cells of the leaf, in pollen, vascular cylinder of the anther and the veins of the lemma, palea and pistils, and in all node I tissues (PubMed:26082401). {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:26082401}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling (PubMed:18263782, PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:25657119, PubMed:26082401). Functionally redundant with PHR1 and PHR3 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). Involved in both systematic and local Pi-signaling pathways (PubMed:19704822). Regulates several Pi transporters (PubMed:18263782). Regulates the expression of PT2 (PubMed:20149131). Directly up-regulates SPX1 and SPX2 expression, but PHR2 binding to DNA is repressed redundantly by SPX1 and SPX2 in a PI-dependent manner (PubMed:25271318). The DNA-binding activity is also repressed by SPX4 (PubMed:24692424). Involved in root growth under Pi deprivation (PubMed:18263782). {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:19704822, ECO:0000269|PubMed:20149131, ECO:0000269|PubMed:24692424, ECO:0000269|PubMed:25271318, ECO:0000269|PubMed:25657119, ECO:0000269|PubMed:26082401}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g25710.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not regulated by Pi starvation. {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:26082401}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g25710
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1000650.0AK100065.1 Oryza sativa Japonica Group cDNA clone:J013160O05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647736.10.0PREDICTED: protein PHR1-LIKE 1
RefseqXP_015647735.10.0PREDICTED: protein PHR1-LIKE 1
SwissprotQ8GUN51e-60PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLB8B5N80.0B8B5N8_ORYSI; Putative uncharacterized protein
TrEMBLQ6Z1560.0Q6Z156_ORYSJ; Os07g0438800 protein
STRINGBGIOSGA025605-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os07g25710.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
MonocotsOGMP19713789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.17e-63phosphate starvation response 1
Publications ? help Back to Top
  1. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]
  2. Zhou J, et al.
    OsPHR2 is involved in phosphate-starvation signaling and excessive phosphate accumulation in shoots of plants.
    Plant Physiol., 2008. 146(4): p. 1673-86
    [PMID:18263782]
  3. Wu P,Wang X
    Role of OsPHR2 on phosphorus homeostasis and root hairs development in rice (Oryza sativa L.).
    Plant Signal Behav, 2008. 3(9): p. 674-5
    [PMID:19704822]
  4. Liu F, et al.
    OsSPX1 suppresses the function of OsPHR2 in the regulation of expression of OsPT2 and phosphate homeostasis in shoots of rice.
    Plant J., 2010. 62(3): p. 508-17
    [PMID:20149131]
  5. Lv Q, et al.
    SPX4 Negatively Regulates Phosphate Signaling and Homeostasis through Its Interaction with PHR2 in Rice.
    Plant Cell, 2014. 26(4): p. 1586-1597
    [PMID:24692424]
  6. Wang Z, et al.
    Rice SPX1 and SPX2 inhibit phosphate starvation responses through interacting with PHR2 in a phosphate-dependent manner.
    Proc. Natl. Acad. Sci. U.S.A., 2014. 111(41): p. 14953-8
    [PMID:25271318]
  7. Ruan W, et al.
    Genetic manipulation of a high-affinity PHR1 target cis-element to improve phosphorous uptake in Oryza sativa L.
    Plant Mol. Biol., 2015. 87(4-5): p. 429-40
    [PMID:25657119]
  8. Guo M, et al.
    Integrative Comparison of the Role of the PHOSPHATE RESPONSE1 Subfamily in Phosphate Signaling and Homeostasis in Rice.
    Plant Physiol., 2015. 168(4): p. 1762-76
    [PMID:26082401]
  9. Wild R, et al.
    Control of eukaryotic phosphate homeostasis by inositol polyphosphate sensor domains.
    Science, 2016. 352(6288): p. 986-90
    [PMID:27080106]