PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g25370.1
Common NameLOC107275464, Os07g0434300, OSNPB_070434300, P0673E01.18
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 193aa    MW: 22123.4 Da    PI: 10.9082
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g25370.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-162367348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +WT+eEd +l ++ k+ G ++W+++ar m+ +R++ +c++rw+ +l
  LOC_Os07g25370.1 23 AWTPEEDARLQRLAKENGFRRWSRVARSMP-RRSARSCRDRWRHHL 67
                      7*****************************.***********9886 PP

2Myb_DNA-binding23.31.5e-0775118348
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       ++T+ +d+ l++++ +lG + Wk I r +  gRt    k+rw+ ++
  LOC_Os07g25370.1  75 PFTARDDDELLRLHYRLGDR-WKEIGRAVY-GRTSRIMKHRWRELR 118
                       79****************99.********9.***********9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.0841671IPR017930Myb domain
SMARTSM007175.5E-132069IPR001005SANT/Myb domain
SuperFamilySSF466891.51E-2321114IPR009057Homeodomain-like
PfamPF002491.1E-142367IPR001005SANT/Myb domain
CDDcd001672.03E-132367No hitNo description
Gene3DG3DSA:1.10.10.602.4E-192379IPR009057Homeodomain-like
PROSITE profilePS500907.36468118IPR017877Myb-like domain
SMARTSM007170.001672120IPR001005SANT/Myb domain
PfamPF002491.4E-575117IPR001005SANT/Myb domain
CDDcd001677.90E-475117No hitNo description
Gene3DG3DSA:1.10.10.601.5E-880118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MATPPLPPPP RARCVVRLKL PPAWTPEEDA RLQRLAKENG FRRWSRVARS MPRRSARSCR  60
DRWRHHLARD VYHRPFTARD DDELLRLHYR LGDRWKEIGR AVYGRTSRIM KHRWRELRRS  120
GFPLAATARK VQALDMVESE VEESDQSLPP PELQRSLADA LASSFGYCSL ANEHAMDPLA  180
GSLSLGFACM AV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-1724114797MYB PROTO-ONCOGENE PROTEIN
1h88_C7e-172411961156MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-172411961156MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-17241197102C-Myb DNA-Binding Domain
1msf_C2e-17241197102C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976103254e-85
Expression AtlasQ6Z3W3-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g25370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g25370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0052000.0AP005200.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0673E01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645964.11e-137PREDICTED: myb-related protein B-like
TrEMBLQ6Z3W31e-137Q6Z3W3_ORYSJ; Myb-like transcription factor-like
STRINGLOC_Os07g25370.11e-137(Oryza sativa Japonica Group)
STRINGBGIOSGA024398-PA1e-137(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP10428310
MonocotsOGMP125692035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.16e-19myb domain protein 70